CAZyme Information: PHYSODRAFT_468978-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_468978-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583		63820.02	4.3586

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:10113161-10114912(+)

Full Sequence      

MPAIVLPVEPDKDTSDQEAVRGFAKYHVGSYLRPPMSALDEINGSYGWTTAQMREFVAGI
QKIAMEENGGHLMVYGTDSAHGNALVTDTVFFGQQINAAATFNPDLAYEQGRITTRDTLA
AGIPWIFDPVLDIMHSPLWPRVYETFGEDPYLASVMGAAVVRGIQSYNESAACMKHWIAY
AWNPTGHDKDGVTMSDFDLLNTYFPSFKAAVDAGLLAGMENYISVNGVPIVENTKLLKTL
LRNDLGFEGLMVTDYGEINALQDFHRTARSENEATKFSLERTSIDMSMVASDLSFTNGTN
KLLEEEPEILDRLKESVRRIIKTKLKLGLYDNPMPGEEYLDMVGNDDDVAAALDSARESI
VLLQNNASTLPLAKDASVFLTGPSADNIGYQCGSWTLQVQGVSGNDMFSHGVSVRQGIEA
IAGNDSFTYFNGLNITGNYTDADLATAKEYAAKAEYTIAVIGEEVYEEKTGDINDLTLPL
GQIEYVKELASTGTKVIVVLFEGRPRILNDLPENVYAVINGMLSCEQGGKAVAEIIYGDV
NPSGRMPITYPKDTGNVMIPYQHSVKAPEKIILIKIHSNTLNQ

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	71	273	1.4e-54	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.57e-82	73	563	106	612	beta-glucosidase BglX.
224389	BglX	1.03e-63	50	424	43	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.05e-47	8	321	12	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	9.06e-45	360	555	1	194	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.45e-41	86	552	108	591	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	3.25e-234	16	565	63	611
UIZ29613.1|GH3	6.93e-209	16	565	107	666
UIZ27116.1|GH3	1.17e-206	14	567	15	570
UIZ29432.1|GH3	4.47e-204	16	565	62	610
CCA27737.1|GH3	1.24e-197	16	567	100	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	7.13e-97	25	552	65	596	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	3.93e-65	8	550	68	587	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6R5I_A	1.02e-61	73	563	74	580	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXL_A	1.48e-61	55	563	67	598	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5O_A	5.10e-61	73	563	74	580	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	2.76e-108	10	563	107	679	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	4.96e-96	25	552	87	618	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	2.75e-66	52	563	91	612	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	3.68e-65	73	563	106	612	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	6.94e-64	64	561	59	573	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_468978-t26_1-p1.