CAZyme Information: PHYSODRAFT_467532-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_467532-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: putative endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		84682.80	4.5148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:6238225-6240552(-)

Full Sequence      

MIRQLLLAASALLARVLLYADESTVSAGNAPDTILPGYLSPFSTDAPSEKLFQRKDGLAA
LAPIINVAEALNAQPIPTNKWWGNLIHTTNEDVDSVANPAWSNPYALKLPKQAPFGLQAC
YSYTYRQLADEVDGVIRYYLHEFHNDVTLSASEFGSTKPDYEIYSFSDMGVALRTCVAGS
SDSDSFNCMDSALVHGMAFVSAAYAGLTPRIESDYAMTLLDSSTPGKYVVRLANNQTWVA
FASDPSVTFSVDSTGSALTAAAGYTGTVRLAVLPESGDQNVYDDYASCVVRGGDVSVQSR
TSYSLDWETGGSGCDSSGLLHFALPHHLDAMDNPTTTQLSGAIVLHSSTRGLMVGQVTTS
GSWTLSEPEADDEVDFYPASKLSADVVSQIGLLSTLQSDIDSSWALDTGSWYFSGKAYQK
YASLCLMAADRAIVGSSRSLLRRCLSKLEALIEPFLTNTLSSPLVYETTYKGIVTSLAFS
TGDINVDFGNGVYNDHHYHYGYWVTASAILKKLDPSWSGMAQLETMVWTLLRDVANPSSD
DEYFPRFRHFSWYLGHSYSHGVTPMADGKDEESTSEDVNFYYGMMLWGKVTQNQAVEDLG
SLMLRLNARAVRTYFLMTSDNTIHPPQFVPNHVTGIFFDNKADYATWFSAEKYCIHGIQM
IPVSPINGLVRTAKFIQEEWDDILSKEAIVTGADTTNAWLSLLLVNEAAINQEDALSKLT
MATMDDGLTRSWALYIAASHRTKPRVATSTCANTVWTAAITFDGEVCLNPSWSSS

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_467532-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	67	735	4.4e-179	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.61e-148	381	734	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	6.46e-139	75	744	89	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.48e-55	75	380	14	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	19	739	33	739
UIZ26440.1|GH81	0.0	19	739	33	739
UIZ26131.1|GH81	1.86e-308	35	749	9	723
UIZ26137.1|GH81	9.21e-307	23	749	104	833
UIZ26602.1|GH81	9.21e-307	23	749	104	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.56e-101	68	739	33	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.75e-101	68	739	58	742	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.82e-97	68	739	33	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.58e-27	60	684	18	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.37e-24	494	728	439	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	6.25e-102	32	738	2	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	2.98e-94	75	738	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.53e-87	43	734	407	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.25e-86	72	734	107	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.66e-86	72	738	457	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000276	0.999696	CS pos: 20-21. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_467532-t26_1-p1.