CAZyme Information: PHYSODRAFT_467505-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_467505-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	JH159151|CGC5	72239.84	4.7135

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:8659530-8661623(+)

Full Sequence      

MSDEFNVANRSFRPGDDHIWTSLDKPDGVNGALEIYSHNMTSTKCDGDTCYFFIEVSDEP
QTIKVYNMYKYPPGYENAHFFYRAAMVQSWNKFCFQGGMLEVRAQLPVASKAYYPTWPGI
WMMGNLGRAIFSASTNRMWPFSYNKCEPDVFNPDNQRISACDDDPGYGMNPNQGRGAPEI
DLLEGGGLAISSSLQIAPGMPMAFRLFPADAAGADATNPYCVYRYDCKTKGANVIDVPTA
YFEQVRGHKSWYQGLRYASNNNCKPDGSAKQDFLTVNKSVAAGIKDNTCTTDTCPASLDV
NGDLDLIDGKGENHWGINTNGTCYPIMNSYMGAYLCDPDNTNTLCTKPRNPTTPKSNTMS
PFNYQMDAISSNWPVHLGAYTDYLVYQMEWVTGENGYVRWMLDGNPIFEVTTDAFSNVPQ
NFNKTNPVKVMLEEPMSLILNTNRICDEFPMYMKIDYIRLYQDLGDDLEADNYMAVGCDP
ASHPTKEWIEGHIDEYSDDDNPVKTVHGKAFCKTNDDCTIGGEVGTTSLKTGSCVKNRCV
CSSTSWSGPRCTEAQSDTSEKSSSLSKRVYGPPMGLSMGVGSIAILISIGSVWLASLVTA
KETQKMMKAKDAEREARQRDAKSATQLSTGGDFDGNASVISQPKDNYKQNFV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	3	201	1.7e-62	0.588957055214724

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	1.16e-53	2	498	122	478	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	3.61e-48	2	462	4	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	1.05e-09	368	461	145	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	1.27e-08	2	125	2	103	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	3.36e-08	81	147	102	157	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27810.1|GH16	0.0	1	610	98	749
UIZ28149.1|GH16	0.0	1	652	62	754
UIZ28151.1|GH16	4.07e-312	1	652	63	752
UIZ28152.1|GH16	9.71e-295	1	652	51	739
UIZ28150.1|GH16	1.11e-278	1	652	1	688

PDB Hits     

PHYSODRAFT_467505-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33336|SKN1_YEAST	9.75e-33	1	496	382	739	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P32486|KRE6_YEAST	1.48e-31	1	496	330	687	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87024|SKN1_CANAX	3.57e-28	1	496	359	714	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	1.05e-25	1	496	355	717	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|O13941|YEPB_SCHPO	7.20e-24	1	492	242	599	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

Start	End
578	600