CAZyme Information: PHYSODRAFT_441237-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_441237-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	JH159154|CGC10	31001.60	9.8005

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:2959822-2961104(+)

Full Sequence      

MAEGNSPFDRTTYRYTPVLAFMLLPNIYVHQVFGKLLFVACDLLVGYVLYRILRLRGLPD
QRETKKAVWLFHPFSVNISTRGNADSIVVLLVMLSLLLIMRKQLVLSALAYGAAVHFKIY
PIIYALAFLVFLNGDFRASNAKWAKSCGSSACVWWKLAGLLNRDRLVFGVVSGLFFLVLA
GGFYYLYGFQFLYEAYLYHFTRTDNRHNFSVYFYDLYLRYNTPSGFGVGLLAFLPQLTSL
VAISFAYGRDLPFALFALTMVFVIFNKVCTAQ

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	78	272	1.4e-64	0.7099236641221374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	7.92e-85	1	272	52	340	GPI mannosyltransferase
252941	Mannosyl_trans	2.05e-48	78	272	1	184	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	3.95e-91	5	272	54	318
AAH01803.1|GT50|2.4.1.-	5.68e-72	1	272	62	334
NP_660150.1|GT50|2.4.1.-	5.68e-72	1	272	62	334
BAB18567.1|GT50|2.4.1.-	5.68e-72	1	272	62	334
CAH05413.1|GT50|2.4.1.-	5.68e-72	1	272	62	334

PDB Hits     

PHYSODRAFT_441237-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9H3S5|PIGM_HUMAN	1.01e-72	1	272	62	334	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	1.01e-72	1	272	62	334	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q66IJ4|PIGM_XENTR	3.60e-72	1	272	58	332	GPI mannosyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=pigm PE=2 SV=1
sp|Q4R4E1|PIGM_MACFA	8.90e-71	1	272	62	334	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1
sp|Q5EA10|PIGM_BOVIN	9.91e-70	1	272	62	334	GPI mannosyltransferase 1 OS=Bos taurus OX=9913 GN=PIGM PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000003

TMHMM  Annotations     

Start	End
27	49
86	100
110	132
166	188
226	248