CAZyme Information: PHYSODRAFT_434567-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_434567-t26_1-p1
• CAZy Family: GH30|GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		41214.30	9.6708

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:8699001-8700191(-)

Full Sequence      

ASVVSGTAPGFAAGTTGGGNAKPVVPSSIQELAAALGGNEPRVIVLKKEFRFVGTEGSKK
EKGCRPKNNIDCIAKKSGFLGQDTIQPSFSQCDGSWIDITYDKAATNPLIVGSNKTLVGE
GSKGVLNGKGLMITGSNVIIQNIHITNLNPHLVWGGDAITIRGNGNVAPKGIWIDHVKIS
NIGRQMIVVNFSGATGLTISNSDFDGNTKYSTSCDGRHYWGFLILGKRTELSLIGNYIHH
TSGRSPKIGGHDGETSVVHAANNYFSENSGHAFDVATGGYVLAEGNYFDSVKQPTIDDPK
GNFLVPYAAGDCRAVIGRDCKLNVVAKSGALKGNSQGKGSQFVNVKSLINQYKVTAATKL
AVGAGNFGVGNLGNNAAQSSPKQSTGSLGNSGAAQSS

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	99	289	2.3e-82	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.33e-37	98	292	1	190	Amb_all domain.
226384	PelB	1.74e-16	111	296	99	281	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	4.68e-11	102	288	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19253.2|PL1_4	4.24e-197	1	373	23	405
ACR19250.1|PL1_4	5.94e-186	2	385	190	574
ACR19256.1|PL1_4	1.51e-184	1	318	29	346
ACR19247.1|PL1_4|4.2.2.10	3.44e-130	5	374	24	400
ACR19251.1|PL1_4	3.44e-130	5	374	24	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.60e-85	4	342	3	333	Pectin Lyase B [Aspergillus niger]
1IDJ_A	9.19e-80	4	372	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	9.19e-80	4	372	3	359	Pectin Lyase A [Aspergillus niger]
1PCL_A	1.09e-06	102	297	69	285	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	8.62e-102	10	380	29	393	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	4.21e-92	4	373	23	388	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	4.21e-92	4	373	23	388	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|B0Y0L8|PELF_ASPFC	7.54e-91	4	372	18	386	Probable pectin lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelE PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	7.47e-90	4	380	24	391	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_434567-t26_1-p1.