CAZyme Information: PHYSODRAFT_420719-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_420719-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276	JH159159|CGC3	31233.59	4.9422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159159:1036454-1037281(+)

Full Sequence      

SNGSDVFLLIGVKTAVVENFAFRQAIRETWASENALPGDAKVLFIGCNPKFDEVPSEVER
EEIKTAINLEKRTYGDLLTEELTCEDSYDDLADKVKQFLRFSALDFPLTPFVMIADDDIY
LRVDRLAGDLRKEDHSQHLYIGQVWDKLLGRSQEPVRGSTERYFIPEDIYPLHSYPPFAF
GPHYVLSMACVRFIAKNHERLRGLDPIDDVSVALWLLTLQVHAEHTPAFSSLGIGVCMGG
LISLANLSPYGIRSIHANIIARRDLCDGFDRITWQK

Enzyme Prediction     

EC	2.4.1.-:43	2.4.1.149:17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	23	225	1e-38	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	1.27e-23	23	227	3	196	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	5.64e-13	8	222	387	585	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAC35564.1|GT31	5.49e-24	1	234	84	309
NP_849210.1|GT31	7.73e-24	1	234	113	338
AAI08348.1|GT31	7.73e-24	1	234	113	338
AAI20586.1|GT31	7.73e-24	1	234	113	338
BAE41109.1|GT31	7.73e-24	1	234	113	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WMN_A	2.54e-15	7	234	110	325	Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_C Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMN_D Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_A Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMO_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens]
7JHK_A	2.63e-15	7	234	116	331	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHK_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHL_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHM_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHN_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_A Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHO_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]
7JHI_A	2.82e-15	7	234	130	345	Chain A, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_B Chain B, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_C Chain C, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens],7JHI_D Chain D, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 [Homo sapiens]
6WMM_A	6.37e-15	7	234	110	325	Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens],6WMM_B Human poly-N-acetyl-lactosamine synthase structure demonstrates a modular assembly of catalytic subsites for GT-A glycosyltransferases [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VI16|B3GN9_MOUSE	1.37e-24	1	234	113	338	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 OS=Mus musculus OX=10090 GN=B3gnt9 PE=2 SV=1
sp|Q17QZ8|B3GN9_BOVIN	8.95e-23	8	234	118	340	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 OS=Bos taurus OX=9913 GN=B3GNT9 PE=2 SV=1
sp|Q6UX72|B3GN9_HUMAN	3.22e-22	8	234	118	341	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 OS=Homo sapiens OX=9606 GN=B3GNT9 PE=2 SV=1
sp|Q66H69|B3GN7_RAT	7.97e-22	5	255	129	366	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Rattus norvegicus OX=10116 GN=B3gnt7 PE=2 SV=1
sp|Q8NFL0|B3GN7_HUMAN	5.50e-21	5	234	133	352	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_420719-t26_1-p1.