CAZyme Information: PHYSODRAFT_414410-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_414410-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		37356.88	4.9756

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159159:1022011-1022994(+)

Full Sequence      

TLTIVSDETFEEYSVAMLKQTDQSQDLPQWNDLAQWARWQKIFDSDLDEMPSSSLLSAEG
GDFLLVIGVKTAVLEGFDRRQAIRETWSSKPELPRDVKVYFVGCASNFDAISSDEKRNQV
QSAINYEKQVYRDLLTDELLCEDWNGNQVNKVKAFLDFAAQTYRHTPFVVIADDTIYLRA
DRLANDLRMENRTQRLYLGQVLDNRSQPGVFPSEHRYIPSKRYSLHNYPSFASSSHYVLS
MGCARFIAKNSARLQGLDGQDGVSVALWLLTIQVHVEHTKAFSDLQDEDCDNGFLSLAGL
SSSGIQKIHANVVERRPFCYGLNRDLFL

Enzyme Prediction     

EC	2.4.1.122:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	79	278	6.5e-29	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	6.59e-12	78	278	1	194	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	1.91e-05	46	295	370	607	beta-1,3-galactosyltransferase; Provisional
178735	PLN03193	6.39e-04	63	278	139	347	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFE67015.1|GT31	2.85e-11	60	245	131	311
AER94883.1|GT31	1.27e-09	61	282	128	341
BAG54296.1|GT31	3.09e-09	61	245	132	311
AAY24246.1|GT31	3.09e-09	61	245	132	311
NP_660279.1|GT31	3.09e-09	61	245	132	311

PDB Hits     

PHYSODRAFT_414410-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NFL0|B3GN7_HUMAN	5.49e-10	61	245	132	311	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
sp|Q5XJP0|B3G5B_DANRE	9.32e-10	62	309	86	330	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase B OS=Danio rerio OX=7955 GN=b3gnt5b PE=2 SV=1
sp|Q6UX72|B3GN9_HUMAN	1.80e-08	58	282	111	336	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 OS=Homo sapiens OX=9606 GN=B3GNT9 PE=2 SV=1
sp|Q66GS2|B3GTC_ARATH	7.06e-08	67	284	114	323	Probable beta-1,3-galactosyltransferase 12 OS=Arabidopsis thaliana OX=3702 GN=B3GALT12 PE=2 SV=1
sp|Q9Y5Z6|B3GT1_HUMAN	8.10e-08	65	283	80	286	Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000045

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_414410-t26_1-p1.