CAZyme Information: PHYSODRAFT_411737-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_411737-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		38487.75	7.6483

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:8126310-8127392(+)

Full Sequence      

PATSILHPLVPVQAPLNTRAGGYSTAQTTSGNVSTTVETFPQYGEDSLPGRLFRLENTAL
LAQPDNKHQDSVLVMVVLRDAQSWGDGRSAEDFFQLLDSFDYPKGKISVTLLVSSMSEFL
LMKTHFQRQIQQYARLSVIFRNDFSPRHVVTRENRHEDHLQVNRRRIIARYRNFAVLSTM
EPWHQHVLWLDADVHKIPSGLLKKIVDSGLDIVEPMCVRMKANGKDWYEYDLNAWVGSRK
VRRSSRDSSFVPGDLNVKRMKQFHGGKDTFVPLDSVGGTMLYVNVDVHRQGVLFPVHHLI
GSEWSSEGYDGIETEGLCYVAHFLGFKCWGMPNDLIYH

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_411737-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	65	296	3e-42	0.9216417910447762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	8.63e-41	67	295	18	262	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43931.1|GT62	2.58e-46	58	338	174	468
CCE80338.1|GT62	1.75e-44	56	338	70	382
CCE81103.1|GT62	1.75e-44	56	338	70	382
ABN65744.2|GT62	2.61e-44	65	338	86	385
SGZ55043.1|GT62	5.12e-44	69	338	84	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	4.25e-16	123	338	79	299	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O36022|MNN9_SCHPO	2.68e-22	93	338	81	334	Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnn9 PE=3 SV=1
sp|P53697|MNN9_CANAL	1.73e-20	139	338	160	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1
sp|O74745|ANP1_SCHPO	2.49e-19	65	338	93	371	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	7.92e-16	70	338	81	354	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P39107|MNN9_YEAST	9.88e-16	123	338	169	389	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_411737-t26_1-p1.