CAZyme Information: PHYSODRAFT_405488-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_405488-t26_1-p1
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	JH159160|CGC6	36354.30	4.1595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159160:1863674-1864705(+)

Full Sequence      

SYPTAVAAYPGLKDSIELIAKQQVANWYTDRVSDVPALAKAVVLPVCSDTNEATAPPTVV
VYGLPQKDCAHGFSTAGSNANSDDYRTFLQQLADAAGSQQVVYILEPDAIGLLADGGCGN
DKGYAENLGVAMDILSQNPNAEIYLDVGYWALSDEDQATAVAKIVNAVDPNCKCKGISLN
TSNYRSNAEMAATCERFVKASGRREYKCIVDTSRNFVSPSSTEWCNANWAGIGELPTTNT
GSEYVSRYVWVNPPGESDGECTNQSDQALRGPDAGVFFPDHFVQLWNNGAFVQKLGMAPI
SVAGNSTSNGTLDTPTPASATVTPVPEPVMVAPTPASTTTTPST

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_405488-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	12	264	5.9e-56	0.9251700680272109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.46e-38	19	262	11	288	Glycosyl hydrolases family 6.
227616	CelA1	1.14e-16	53	318	182	459	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA20052.1|GH6	6.98e-92	1	300	4	309
AIG55974.1|GH6	4.40e-78	1	301	33	325
AIG55776.1|CBM1|GH6	5.84e-78	1	299	29	311
AIG55493.1|GH6	3.89e-77	1	304	29	312
UIZ23635.1|GH6	2.19e-75	1	305	31	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JX5_A	1.58e-30	51	288	61	317	GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_A GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102]
1UP2_A	2.45e-28	36	288	50	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	4.71e-28	36	288	50	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	4.71e-28	36	288	50	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	7.01e-28	36	288	71	312	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26414|GUNA_THEBI	4.37e-29	57	290	102	322	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P26222|GUN2_THEFU	1.27e-24	57	259	99	297	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|Q7SIG5|GUN6_HUMIN	1.43e-23	59	290	83	342	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|A2QYR9|CBHC_ASPNC	2.10e-22	3	288	123	454	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1
sp|P13933|GUN1_STRSS	3.95e-22	17	259	105	340	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999353	0.000683

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_405488-t26_1-p1.