CAZyme Information: PHYSODRAFT_388889-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_388889-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		38914.30	7.1662

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:9573047-9574057(-)

Full Sequence      

APEPPVTSVLHPITPEQEPLNPNVAFRIQSTEAHFTEYEESFPQYGKIEPGRHYRIENKP
VLTRLGNRETDSVLIICVFNDKNSWGGNRTVTDFFDLVGSFNYPKEKISISMLTSSLDEF
AKVRTLLKKYIQYPRLSLMFRDDFAQNGLTRGNRHEGPRQGDRRRMIARYRNYVLMSSLE
TWHQHVLWLDADIEIIPSHLLPKMVHSGLDILTPTCFNRHKGVWINYDQNGWVGQRKERP
ADLADDEFFMPGPLRVKLLNTVDDKSKPFTPMDSVGGTMLYVRAEVHRQGVIFPMHYVIG
SKWGHEGYDGIETEGLCYTAHFLGFKCWGMVNESIQH

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_388889-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	66	295	2.5e-40	0.9216417910447762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	9.16e-41	93	294	38	262	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SGZ55043.1|GT62	3.69e-49	63	337	77	375
SGZ55181.1|GT62	3.69e-49	63	337	77	375
CDR43931.1|GT62	2.51e-46	67	337	182	468
QFZ40297.1|GT62	1.92e-45	68	337	98	391
QFZ51639.1|GT62	1.92e-45	68	337	98	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	3.98e-18	94	337	40	299	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O36022|MNN9_SCHPO	5.96e-25	102	337	89	334	Mannan polymerase complex subunit mnn9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnn9 PE=3 SV=1
sp|O74745|ANP1_SCHPO	1.32e-21	94	337	116	371	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P53697|MNN9_CANAL	5.93e-20	53	337	75	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1
sp|P39107|MNN9_YEAST	1.04e-17	94	337	130	389	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3
sp|Q00314|VAN1_CANAX	8.19e-17	139	337	216	418	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_388889-t26_1-p1.