CAZyme Information: PHYSODRAFT_371911-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_371911-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		42381.94	9.5533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:8709288-8710508(-)

Full Sequence      

RQVTVLLSLALALVGFVTSDASVVSGTAPGFATGTTGGGNAKPVVPNSIQELAAALGGNE
PRVIVLKKEFRFVGTEGSKKEKGCRPKNNIDCMAKKSGFLGQDAIQPSFSQCDGSLIDIT
YDKAATNPLIVGSNKTLVGEGSKGVLNGKGLMITGSNVIIQNIHITNLNPHLVWGGDAIT
IRGNGNVAPKGIWIDHVKISNIGRQMIVVNFSGATGLTISNSDFDGNTKYSTSCDGRHYW
GFLILGKRTELSLIGNYIHHTSGRSPKIGGHDGETSVVHAANNYFSENSGHAFDVATGGY
VLAEGNYFDSVKQPTIDDPKGNFLVPYAAGDCRAVIGRDCKLNVVAKSGALKGNSQGKGS
QFVNVKSLINQYKVTAATKLAVGAGNFGVGNLGSSGSAKQGVDQSPI

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	119	309	2.5e-82	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.36e-37	118	312	1	190	Amb_all domain.
226384	PelB	4.73e-17	108	316	86	281	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.33e-11	122	308	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19253.2|PL1_4	2.33e-199	21	395	23	407
ACR19256.1|PL1_4	4.04e-187	1	338	6	346
ACR19250.1|PL1_4	3.06e-186	18	397	187	566
ACR19247.1|PL1_4|4.2.2.10	1.98e-129	25	392	24	398
ACR19251.1|PL1_4	1.98e-129	25	392	24	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.27e-85	24	362	3	333	Pectin Lyase B [Aspergillus niger]
1IDJ_A	2.24e-80	24	392	3	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	2.24e-80	24	392	3	359	Pectin Lyase A [Aspergillus niger]
1PCL_A	8.57e-07	75	317	19	285	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	2.15e-102	9	395	9	388	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B8N316|PELF_ASPFN	9.26e-94	10	398	10	393	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	9.26e-94	10	398	10	393	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|A2R6A1|PELF_ASPNC	5.20e-90	10	398	10	390	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	5.20e-90	10	398	10	390	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999710	CS pos: 21-22. Pr: 0.8577

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_371911-t26_1-p1.