CAZyme Information: PHYSODRAFT_365081-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_365081-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	JH159153|CGC6	62834.22	4.3450

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:8307708-8309516(-)

Full Sequence      

STSGGSVPDGTWPTSAGTVQFAEARIVKAGEVFDGKMKTYERSDVSCEGQTESGADTAVF
KMEPGSTLKNVIIGKNQMEGVHCDKHDCTIENVWWDDVCEDALSVKGGTASSVTTVTGGG
ARSADDKVIQHNGFGTVKIDGFYGEDISKLYRSCGTCGDKQRKVDVSNVYIVNPDNAVVT
VNKNWKDEATLSNIWVKSSGKKVKICQWSQGNADGEPSMLGDGPSPPLCQYSESDIHLNQ
DVSKAGGSTPSQGSTPSTPSTPSTPSEGSSTSESEPTTPAPASDAGESGEDAPVQTVGGS
QTSETPTTESSGTDNGGDEETSVSKGGDDGENTSTGSETSGGETTQGSSTSAGSQTQSQT
TPSSSAGGTLPDGTWPTSTGSVKFTAPRVIKAGEVFDGKMQTFDRSDITCTGGEGQKDTA
VFLVEAGGTLKNAIIGKNQKEGVHCDDHDCTIENVWWDDVCEDALSIKGGTASSVTTVTN
CGAKSASDKVVQHNGQGTVNIDGFYAEEFGKLYRSCGTCGDIPRTVTLKNVYAVNPLVSV
VTVNKNYGDKATLSNIWVKTSNGKDDVKVCQWSQGSKDPKNVGDGPSPPLCQYTDSDIHI
NQD

Enzyme Prediction     

EC	4.2.2.2:4	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	16	211	2.7e-78	0.9896907216494846
PL3	378	573	1.3e-75	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	5.13e-86	373	575	2	195	Pectate lyase.
397360	Pectate_lyase	1.91e-82	10	215	2	199	Pectate lyase.
240430	PTZ00473	6.46e-05	296	365	332	402	Plasmodium Vir superfamily; Provisional
236504	PRK09418	4.03e-04	284	363	658	739	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
411053	dermokine	0.001	277	380	203	302	dermokine. Dermokine, also known as epidermis-specific secreted protein SK30/SK89, is a skin-specific glycoprotein that may play a regulatory role in the crosstalk between barrier dysfunction and inflammation, and therefore play a role in inflammatory diseases such as psoriasis. Dermokine is one of the most highly expressed proteins in differentiating keratinocytes, found mainly in the spinous and granular layers of the epidermis, but also in the epithelia of the small intestine, macrophages of the lung, and endothelial cells of the lung. Mouse dermokine has been reported to be encoded by 22 exons, and its expression leads to alpha, beta, and gamma transcripts.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18841.1|PL3_2	4.88e-156	2	251	16	265
ADN18837.1|PL3_2	2.33e-108	6	236	30	258
ADN18840.1|PL3_2	3.70e-104	7	236	31	258
ADN18836.1|PL3_2	1.71e-81	375	587	22	236
ADN18839.1|PL3_2	6.89e-79	363	600	16	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	7.60e-25	27	155	11	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B90_A	8.42e-21	391	575	4	196	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	1.42e-20	15	155	4	138	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.46e-20	15	155	5	139	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
3B4N_A	6.49e-20	391	575	122	314	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ20|PLYG_ASPTN	2.96e-57	13	233	28	241	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|Q0CJ49|PLYD_ASPTN	3.81e-55	376	595	35	248	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	5.17e-55	376	595	22	236	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	5.29e-55	376	595	43	259	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	2.02e-54	376	595	23	237	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000016

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_365081-t26_1-p1.