CAZyme Information: PHYSODRAFT_360375-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_360375-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: putative glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		20076.77	9.9150

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:984959-985528(+)

Full Sequence      

MKSFLQLVVVVAALLSVSTADFCSQWRLSKAGKYVIYNNLWNKNAAASGSQCTGVDKISG
STIAWHTSYTWTGGAATEVKSYSNAALVFSKKQIKNIKSIPTKMKYSYSHSSGTFVADVS
YDLFTSSTASGSNEYEIMIWLAAYGGAGPISSTGKAIATVTIGSNSFKLYKGPNGSTTVY
QPPGLPLST

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	91	180	1.7e-24	0.5769230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	1.38e-31	32	180	1	145	Glycosyl hydrolase family 12.
235746	PRK06215	1.09e-12	23	180	41	177	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB92621.1|GH12	2.67e-130	1	189	1	189
EGZ16757.1|GH12|3.2.1.151	1.68e-106	1	180	1	180
ABB22029.1|GH12|3.2.1.151	1.68e-106	1	180	1	180
ABB22037.1|GH12	5.96e-99	1	180	1	176
ABB22036.1|GH12	8.84e-85	1	180	1	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VLB_B	4.79e-62	20	180	5	161	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	5.94e-62	20	180	12	168	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
4NPR_A	3.75e-53	18	180	23	182	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
6K9D_A	9.35e-37	23	177	4	152	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
5GM3_A	5.39e-36	20	180	1	157	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4ZHR3|XLP1_PHYSP	4.75e-131	1	189	1	189	Inactive glycoside hydrolase XLP1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XLP1 PE=1 SV=1
sp|G4ZHR2|XEG1_PHYSP	2.98e-107	1	180	1	180	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1
sp|W2PDG1|XLP1_PHYPN	1.15e-101	1	180	1	177	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|W2PEP3|XEG1_PHYPN	1.81e-101	1	180	1	180	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XEG1 PE=1 SV=1
sp|O94218|XGEA_ASPAC	4.03e-61	20	180	21	177	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus aculeatus OX=5053 GN=xgeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000185	0.999814	CS pos: 20-21. Pr: 0.9755

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_360375-t26_1-p1.