CAZyme Information: PHYSODRAFT_355223-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_355223-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: putative glycosyl hydrolase family 6 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		48026.03	4.5066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159157:3550618-3552015(-)

Full Sequence      

MLRKILHSRLVVAAVSCVALALSSSIAAAEDLCSIVPASYTGAKSDHPELTTAIETLEKY
AIASWYTDRMSSQERSDMVSGLLSQCSEDTRLSIVVYGIPNKDCAAGLSSGGSVTSTSDY
QAFLKELTDGVGDRKVLYVVEPDALGLLTQDGGCGASAGYLDNLKIAVAALSANANAELY
VDVGYWMLAYGDSASKVATVMKELGSSGRVKGVTINTSNYRSTDECAGYCTNFQSAMGSS
DMRCIVDTSRNYNGSPNSDWCNVPTAGVGKPPTSETGVSNLDYFMWIKPPGESDGECATG
GTAAGSFYLEGFTSLWDQGYFVAEQGMPKIGDSSSTYTQSPATTAPASGSSNAGQTTSTA
TTAPSGGSSSWSQETTVGTVAPADTTQTEAPAATTATPYTATTTTVTTSPSTTAPVSGTA
SPSTTVSPVTTTTAPTAETASTTTQQSNATQRRTACKAKKRLRSL

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_355223-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	43	298	3.8e-61	0.9421768707482994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	8.37e-45	48	302	2	292	Glycosyl hydrolases family 6.
227616	CelA1	1.76e-15	86	372	180	495	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	3.04e-184	6	348	2	340
UIZ23641.1|GH6	3.00e-91	29	326	25	328
AIG55974.1|GH6	7.70e-85	27	330	20	324
CCA16954.1|GH6	2.37e-82	30	342	21	336
AIG55776.1|CBM1|GH6	8.36e-81	35	333	25	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TML_A	2.91e-30	64	301	40	272	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]
1UP3_A	6.56e-30	94	307	73	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	6.56e-30	94	307	73	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	1.01e-29	94	307	94	301	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	1.72e-29	94	307	73	280	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26414|GUNA_THEBI	3.08e-33	38	301	48	307	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P26222|GUN2_THEFU	1.49e-28	13	301	16	303	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P07984|GUNA_CELFI	4.22e-26	56	310	203	438	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|Q7SIG5|GUN6_HUMIN	2.52e-25	88	318	77	340	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P13933|GUN1_STRSS	4.07e-25	63	295	113	340	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999715	CS pos: 29-30. Pr: 0.9498

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_355223-t26_1-p1.