CAZyme Information: PHYSODRAFT_350021-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_350021-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1022	JH159152|CGC6	114803.58	4.9436

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:6618722-6621790(+)

Full Sequence      

MTWRPRRVLLLAAAALALTDTAAVDRSKFRTCEKTQFCNKFRNVQREPLAAQLQVARDSV
TPDADAKLVRFLVEDAAQRGGVALEGSLTFVLGEDKARVPALRVRLREKFADPQDPKTRW
TSDDVLVPAADETRALRQVTAAEAGLKTPVDDKDVLLFAPEGDKPQVVAALKLGGTFGVD
LYLDGEKAVSTNDDGLFHYEIRQDRADAEAQADAAADQAAVDAHGGKTIVDYGEDGLAIY
DDGTVQKKEEHSATTTATVGADGKVEGWEESFGGHTDKKKFGPSSIGLDVSFHGSAAAPR
TLYGIPEHATDFALKDTIEADEGGEQTRKVVTDPYRLYNLDVFEYELDNPMALYGAIPVL
VAPNKENTVGMFWNNPSETFVDIWTNEDAHSKSTHWLSESGVFDLFLLAGPSSAELFSQY
TLLTGRAQLPPLFALGYHQCRWNYKNEADVARVDAGFDEHLIPYDVLWLDIDHTDGKRYF
TWDEHAFPTPKDMQESVARTGRKMVTIVDPHIKVSQTKDKQPYYIHTEAEELGLFIKDEQ
GNDFKGWCWPGESSYVDFTSPKARAWWRHQFRYENYQGSTNHLYTWNDMNEPSVFNGPEV
SMRKGCMSIAGVEHREWHNLYGTLFQRSSMEGQLVRQQPPPEPLSAFAEELQLTSDMQRP
FVLSRAFSAGSQRYGAIWTGDNTAEWGHLRYATKMLLSMSVAGLTFVGADVGGFFGNPST
ELLTRWNQAAVYQPFFRGHAHHDSARREPWVFGEPTTSRIRAAIRERYSLLPYIYTLFYT
CNARGMPVMRPLWAHFTQEPQSFSEEDQYLLGDALLVKPIVEEGVEATHVFLPSDGAEDK
TVWYQLTDGYKRFFGGKTHENVPAPLDAIPVFQRGGTILPRKQRVRRSSELMRDDPLTLV
VALDQHFKARGELYVDDERSLAAELEGEGTLVSFELTKDGLRSTAAAATQQGKRYTSLMW
VERIEVYGFQSEANLPKQVLVGGERAVEFQYDAASDRLVLRKPQVLVTDDWELRFVYDQA
LE

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	406	879	1.2e-145	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269889	GH31_GANC_GANAB_alpha	0.0	425	920	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
395838	Glyco_hydro_31	0.0	406	879	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	7.75e-171	282	970	139	756	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	5.78e-137	425	779	1	333	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	9.56e-106	411	988	164	688	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21254.1|GH31	0.0	9	1022	6	1019
CCA25893.1|GH31	0.0	15	1018	13	1006
ACI64826.1|GH31	1.26e-268	184	1013	17	855
AAB18921.1|GH31|3.2.1.84	3.75e-265	8	1014	8	941
AFO95770.1|GH31	6.89e-261	7	1013	7	965

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KRY_A	5.68e-257	8	1013	16	940	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]
5IEF_A	2.30e-256	24	1013	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	2.38e-256	24	1013	1	909	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
5F0E_A	4.62e-255	24	1013	1	854	Murine endoplasmic reticulum alpha-glucosidase II [Mus musculus],5H9O_A Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5H9O_C Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5HJO_A Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJO_C Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJR_A Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus],5HJR_C Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus]
7JTY_A	5.83e-254	8	1013	16	962	Chain A, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7JTY_C Chain C, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7K9N_A Chain A, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7K9N_C Chain C, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7K9O_A Chain A, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7K9O_C Chain C, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7K9Q_A Chain A, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7K9Q_C Chain C, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7K9T_A Chain A, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7K9T_C Chain C, Alpha glucosidase 2 alpha neutral subunit [Mus musculus],7KAD_A Chain A, Isoform 2 of Neutral alpha-glucosidase AB [Mus musculus],7KAD_C Chain C, Isoform 2 of Neutral alpha-glucosidase AB [Mus musculus],7KB6_A Chain A, Isoform 2 of Neutral alpha-glucosidase AB [Mus musculus],7KB6_C Chain C, Isoform 2 of Neutral alpha-glucosidase AB [Mus musculus],7KB8_A Chain A, Isoform 2 of Neutral alpha-glucosidase AB [Mus musculus],7KB8_C Chain C, Isoform 2 of Neutral alpha-glucosidase AB [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94502|GANAB_DICDI	6.66e-266	8	1014	8	941	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|Q4R4N7|GANAB_MACFA	7.13e-260	9	1013	18	941	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
sp|Q14697|GANAB_HUMAN	3.21e-258	9	1013	18	941	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3
sp|P79403|GANAB_PIG	9.08e-258	9	1013	18	941	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	9.08e-258	9	1013	18	941	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001005	0.998982	CS pos: 23-24. Pr: 0.8752

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_350021-t26_1-p1.