CAZyme Information: PHYSODRAFT_346433-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_346433-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	JH159154|CGC5	53174.86	8.4899

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:7419115-7420539(-)

Full Sequence      

MEWRSSARSKVSARSNGATPRRSSSGRWLLSLLLLSLASYSALLLAWSSASLSPFRSPLT
DANDSNSTQVGTLIALPMGDTMERSLRCIGWRATLDCTPFGPRDPQRDQPCGRTVHNSNA
GYCEVQDTCTGEHFRVMRRHCSSLFPASRLRCDDALAFVDFRVKARKAVAKALVPGFALP
NVVEGGSDKPRDGIVIVVYPKLVASASALIRTLRESGCKLPIQLWYCPQELYSFPGPLTP
LHHLADSDDQISFHKIDDTRAMGFGAKVYSIYHSTLDRVLFLDADNFPVRDPSSLFHSSE
FERTGAVIWPDYWHPNHTIFNIHEKSMLWELLDMPYADMFEQESGQLLIDRRRHAAPMKL
AFFYMFHRPNFFQELKVAHGDKDLFRFAWLKLEAPFHMAQTPPAVAGEIIDDLFCGMTMA
QHDLEGNVLFLHRNQFKLTGKLAGLKKREAPVADGRSSGRICCLSTARSKSSTT

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_346433-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	192	423	1e-50	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.25e-38	192	423	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.004	277	321	91	143	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	1.17e-100	196	442	1	253
CCA25306.1|GT71	4.31e-97	86	442	69	450
UIZ27901.1|GT71	5.59e-93	83	441	67	422
UIZ24000.1|GT71	1.83e-91	60	439	76	492
CCA25989.1|GT71	2.56e-90	88	439	98	461

PDB Hits     

PHYSODRAFT_346433-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38069|MNN2_YEAST	3.59e-18	192	423	171	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|P46982|MNN5_YEAST	4.62e-17	192	447	150	457	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|A6ZQE9|MNN5_YEAS7	8.19e-17	192	425	150	435	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|Q5AD72|MNN24_CANAL	5.38e-16	192	397	293	530	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q5AP90|MNN23_CANAL	7.79e-14	179	449	160	486	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999973	0.000019

TMHMM  Annotations     

Start	End
28	50