CAZyme Information: PHYSODRAFT_345489-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_345489-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456		50940.70	5.8200

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:3956933-3958584(-)

Full Sequence      

MLALAWLSWLLLLGPTRESAARSAPVYDARGLFADRLTHDDRARLRSCPCSGRPNNSDEQ
LSSLASLCLPVDFTGKRPRKEVFAFSVATDDRWKHYDWDQVLYALLLDPRRPLTTVAWNE
DKQLLCHAHSKGVKVVVKHNFDDVEQLCNTTARQNWIKLGAASGMLACLSFCLGLAEKQT
NGAPLFCGLQATYTQIVENYADGVNIDTEKPMHGATAQCMASLVYELRHELEQHALTKNA
QITFDVPWAPRGVDGRYYPWRELADAADFLFVMSYDMRSQVYDACVAGANAPRALVQQGL
EEFLLAFDIAPDKLVLGVPWYGYDYPCLGPQQGAVIDDASRCRIRPVPFFGAPCSDAAGG
QVDYADVQRLVKRHGLVEQWDPTTETPFVWYAQEGHQSQIWFDNPRSLRAKYRLVRELGL
RGVGMWNADTLDYSGGGSAANDTRLMWSSLAEAFAS

Enzyme Prediction     

EC	3.2.1.-:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	192	429	1.4e-36	0.652027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119354	GH18_chitobiase	6.74e-108	46	450	17	358	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
214753	Glyco_18	4.15e-33	202	430	109	333	Glyco_18 domain.
119353	GH18_CFLE_spore_hydrolase	1.66e-26	198	426	102	300	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
395573	Glyco_hydro_18	7.29e-26	202	429	106	305	Glycosyl hydrolases family 18.
226376	YaaH	2.92e-18	202	426	209	405	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27644.1|GH18	4.48e-213	5	456	424	839
CCA16750.1|GH18	2.17e-127	41	449	28	380
CCA27450.1|GH18	4.66e-127	45	449	3	351
AIG55971.1|GH18	2.20e-102	41	453	20	384
AAA40924.1|GH18|3.2.1.-	7.91e-77	41	450	19	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	3.13e-13	189	435	106	354	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6JM8_A	3.13e-12	189	435	106	354	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
3CZ8_A	1.14e-11	194	426	97	306	Chain A, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5WUP_A	5.38e-11	202	441	210	448	Crystal structure of a insect group III chitinase (CAD1) from Ostrinia furnacalis [Ostrinia furnacalis],5WV9_A Crystal structure of a insect group III chitinase complex with (GlcNAc)6 (CAD1-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
6KST_A	2.12e-10	202	426	118	352	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01460|DIAC_RAT	1.40e-77	41	450	19	363	Di-N-acetylchitobiase OS=Rattus norvegicus OX=10116 GN=Ctbs PE=1 SV=1
sp|Q8R242|DIAC_MOUSE	5.95e-76	43	450	18	362	Di-N-acetylchitobiase OS=Mus musculus OX=10090 GN=Ctbs PE=1 SV=2
sp|Q01459|DIAC_HUMAN	8.86e-74	67	447	48	375	Di-N-acetylchitobiase OS=Homo sapiens OX=9606 GN=CTBS PE=1 SV=1
sp|Q8T293|DIAC2_DICDI	2.08e-52	48	454	26	374	Probable di-N-acetylchitobiase 2 OS=Dictyostelium discoideum OX=44689 GN=ctbs2 PE=3 SV=1
sp|Q7KWW8|DIAC1_DICDI	2.47e-49	42	431	17	352	Probable di-N-acetylchitobiase 1 OS=Dictyostelium discoideum OX=44689 GN=ctbs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999725	CS pos: 21-22. Pr: 0.8809

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_345489-t26_1-p1.