CAZyme Information: PHYSODRAFT_342802-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_342802-t26_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		37741.77	4.3236

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159171:173027-174356(+)

Full Sequence      

MVYNAFAVYDNTLGFSVGNENNLQVKNGAAGTTTAPCVKAFLRDTRSYAASCSGSVRQVP
IGLDIADIPPREQWISYYDCAIDDDENTRAEWMGFNPYVEGDPATHLEYSQSTGLKKLMS
EYAEVGYAHPLMFGEFGCNKGKNTVEGYENQRSFLDAKWMNEEKEMTDEIVGSNVFEFTT
EIANLVESKTLTKTGDAGKYGVGYFMPEDCDNELTECVFTPYPEYDNLKKAYTTTKNSTV
EHDSYTPTRTAILECSKNISSELPPTPKVPVLECTITQPVCNGIKGNSYEHHSTGAAVGE
KRTPTNEESSSASITDATTGSSGASATASAAAFVLSVATVAATAMSLF

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_342802-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	2	187	6.4e-33	0.5256410256410257

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	4.29e-20	2	232	127	311	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24052.1|GH72	4.61e-164	1	313	646	957
CCD28126.1|GH72	3.11e-144	72	341	1	271
AIG55825.1|GH72	5.12e-117	1	299	151	453
AIG56180.1|GH72	4.97e-110	1	297	167	466
CCA15748.1|GH72	1.21e-100	1	320	2312	2626

PDB Hits     

PHYSODRAFT_342802-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q08193|GAS5_YEAST	9.89e-13	6	196	146	319	1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS5 PE=1 SV=1
sp|Q5AJY5|PGA4_CANAL	2.96e-12	6	268	138	357	1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PGA4 PE=1 SV=1
sp|Q9Y7Y7|GAS4_SCHPO	4.15e-10	5	181	142	301	1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gas4 PE=1 SV=1
sp|Q08271|GAS4_YEAST	4.27e-09	2	184	143	306	1,3-beta-glucanosyltransferase GAS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS4 PE=1 SV=1
sp|P0C955|GEL3_ASPFU	2.62e-08	2	281	137	375	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000025

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_342802-t26_1-p1.