CAZyme Information: PHYSODRAFT_340200-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_340200-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		43181.56	3.8224

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159161:1834502-1835739(+)

Full Sequence      

MVCTSYMTVVGMLAALALGATEATLPGVCYAPWHHDTVTSDVLATDMAQIAQYFSAFRSF
QAQYSGINVIETAANAGLKVAVGVQLTDSSAIDTEIEAVCDGYSSYPDAIEAVYVGNEDL
VNGDYGTFSADTLAGYISQVKACTSNAVPVGSVQRINEWLNADGASTLAAACDVIGVNIY
PFFTEGDDSSVTKLEAQWAQMLAAGYDESTMHLTETGWPYEGDDYEGNSPSYDGMQQYLD
DWATWSSSVQSSYWFMMYDTTTSYTGANYETHFGVFGDDMQLQHRHDDDDVHHLVHHQRR
RHSAADHAELGVDHHGRQQTVTESSASTTTDDSTQQQDQTVTEASASEETATVTETATPA
PTTSTSVDASEEEDDSTVTATDSPTVTVATTTTTSTTANCAM

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_340200-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	27	284	3.9e-19	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.43e-16	27	239	47	262	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
311610	Glyco_hydro_53	0.001	110	254	126	295	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
366033	Glyco_hydro_17	0.001	35	282	15	303	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	1.86e-103	8	279	11	280
UIZ21797.1|GH17	7.92e-92	20	279	566	825
UIZ21931.1|GH17	1.69e-68	27	276	29	277
UIZ21795.1|GH17	1.62e-52	27	200	29	202
CCA18992.1|GH17	5.48e-41	13	275	8	270

PDB Hits     

PHYSODRAFT_340200-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9Q9|BTGE_ASPFC	1.83e-12	40	222	326	508	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	1.83e-12	40	222	326	508	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	5.64e-12	27	222	297	495	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999712	CS pos: 23-24. Pr: 0.8793

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_340200-t26_1-p1.