CAZyme Information: PHYSODRAFT_338541-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_338541-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	JH159159|CGC10	30935.64	6.4802

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159159:1290916-1291893(-)

Full Sequence      

MRIFALPLVALASLLVSSSTECSCNGPDARTQPPANAIVGDPTGAYSGSFRNVSEAVGNV
PNNTDEHTIFLFPGVYREQVLISKLNGPLVLQGYTCNTTSYAANEVTITHAKAQRDIPPE
ITSGRNDLTSTLRLKTNNVKGKELFARSYISGDVDFIFGTKAEAWFESCDIEPVGPGCIT
ANRRVNESSPSFYVFNNARVFSSIGNGTAYLGRPWRPYSRVVWQNSELSDVIHPDGWQQW
NKDKKTANRVSFSGVLDAPVPITQILGDNYTSEWYVDHKFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	140	246	3.3e-34	0.3854166666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	9.12e-29	35	241	31	274	probable pectinesterase
178051	PLN02432	1.46e-25	48	245	21	244	putative pectinesterase
178372	PLN02773	2.93e-24	47	247	14	258	pectinesterase
215117	PLN02176	6.54e-24	28	241	31	281	putative pectinesterase
395871	Pectinesterase	1.60e-23	47	254	9	276	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ63096.1|CE8	8.97e-155	1	281	1	344
ACO54873.1|CE8	2.57e-154	1	281	1	344
ACO54871.1|CE8	6.57e-132	1	280	1	343
ACO54875.1|CE8	3.42e-114	1	281	1	346
ACO54869.1|CE8	1.50e-113	1	281	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	7.03e-28	28	237	1	245	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	9.79e-28	28	237	1	245	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.20e-16	47	241	16	253	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	4.31e-14	35	243	3	251	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.69e-42	30	280	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.13e-38	11	281	6	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q5B7U0|PMEA_EMENI	2.66e-32	29	237	28	271	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|B0Y9F9|PMEA_ASPFC	5.09e-32	30	237	28	270	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	5.09e-32	30	237	28	270	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001344	0.998647	CS pos: 21-22. Pr: 0.9452

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_338541-t26_1-p1.