CAZyme Information: PHYSODRAFT_338539-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_338539-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	JH159159|CGC1	31034.35	5.0627

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159159:1281435-1282379(-)

Full Sequence      

MRIFALPLVVLTTLIATASAGYTCAGPDARTQPPVGSIVVDPTGAYSGSFRNGYTCNTKS
YADNEVTITQAKAQKDILPEIKNGRNSLTSTLLLKSNNVRTYNLNVANTAGKFLQDGQAV
AVDIEGDNYGFYACNISGYQDTVYANKGREVFARSYISGAVDFVFGSLAAAWFDPSYFVF
NNTRVFGSYGNSSSDLGRPWHPYSRVVWQNSELGDSINTDGWQIWDNSNSTANVSFLEFN
NRGPGAATDKRVSFGKVAKADVDITELFGENYKNEWWVDHTFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	65	174	1.7e-27	0.3541666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177848	PLN02197	9.70e-33	87	272	354	570	pectinesterase
395871	Pectinesterase	6.97e-30	108	253	98	273	Pectinesterase.
178113	PLN02497	5.32e-29	119	256	142	304	probable pectinesterase
178346	PLN02745	6.90e-28	63	252	325	557	Putative pectinesterase/pectinesterase inhibitor
215130	PLN02217	7.40e-28	64	278	310	550	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ63096.1|CE8	8.99e-139	1	283	1	344
ACO54873.1|CE8	2.57e-138	1	283	1	344
ACO54871.1|CE8	3.71e-122	1	282	1	343
ACO54874.1|CE8	9.84e-105	1	283	1	348
ACO54869.1|CE8	1.43e-104	1	283	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.16e-33	53	282	61	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.16e-33	53	282	61	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	2.45e-21	106	254	99	277	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	7.94e-19	108	269	105	295	Pectin methylesterase from Carrot [Daucus carota]
3UW0_A	8.55e-10	38	250	62	339	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.54e-44	53	283	81	331	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	2.90e-40	53	283	81	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|A1DBT4|PMEA_NEOFI	6.25e-36	53	282	86	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.23e-35	53	282	86	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.23e-35	53	282	86	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999760	CS pos: 20-21. Pr: 0.9751

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_338539-t26_1-p1.