CAZyme Information: PHYSODRAFT_338028-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_338028-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	JH159158|CGC22	47440.32	6.5003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159158:3129675-3130981(+)

Full Sequence      

MRFSFAALAASVGLTLSNGAVEALNVKFPGVNYIPRKGQDWEPDSAKCKSTAEMQKDLNA
LSAVADKVRIYSLIDCNQAETILPAAKKAGLKVDLGIWTTFNHSTLEKEKTKLASLIDAG
LYDDNVIGFDVAIYMYEKFEVDTAISYVKEIRDYLRSRGKNTPVTLADTYDVYTEKVVDA
VDYVAVNYQSFMYGDDVNESVANTLKDLKDLRVLAASKGKKFVISETGWSSGGFHQGVGV
ATPATQAKYFSDLYQVSRSHNFDFYWYFAFDTTFRTEIENDFGVFYNNGTLKRNLQHLTI
HTRDPRALRNVGSKLLLSEKDTNLTMTGKSSDWVVQEQQVWFFDAATKQIRSKSSDRCLD
AYEGWNSGKVHVYRCMDNELNHAKHQGFCLDSDPAQNNKVQLYGCSPNNPNQEWSVIKPA
NI

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	139	294	4.4e-16	0.5112540192926045

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.21e-28	3	288	11	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	8.22e-13	307	414	4	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	5.29e-08	349	418	4	86	Ricin-type beta-trefoil lectin domain.
238092	RICIN	9.87e-08	339	414	36	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	4.97e-07	349	418	2	84	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC18030.1|CBM13|GH17	1.06e-180	1	422	1	443
QBC18033.1|CBM13|GH17	1.06e-180	1	422	1	443
QBC18036.1|CBM13|GH17	1.06e-180	1	422	1	443
QBC18035.1|CBM13|GH17	1.06e-180	1	422	1	443
QBC18037.1|CBM13|GH17	1.06e-180	1	422	1	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.53e-23	28	284	37	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.66e-22	28	284	37	281	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WUK5|BTGC_ASPFU	5.86e-20	24	289	380	656	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	5.86e-20	24	289	380	656	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|A1DEV5|BTGC_NEOFI	5.87e-20	24	271	380	646	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	1.03e-18	24	271	347	613	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|A1CAI0|BTGC_ASPCL	1.95e-17	24	277	387	659	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999770	CS pos: 23-24. Pr: 0.9681

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_338028-t26_1-p1.