CAZyme Information: PHYSODRAFT_337991-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_337991-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	JH159158|CGC13	82188.36	5.1503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159158:2984200-2986542(-)

Full Sequence      

MVKSWLAVAFLSLPGVATALTAANTNSFDAQAQAIVDGFSAAEILGQMTQLDLSTVMNNV
TRELNETAVRMFAKRSVGSYFNTYYEEKPFKGYYGYNATGFRTLVNRIQEISMEENGGHP
LPHQINSAASFNLDLVHKVGQITARDTEAAGISWIFGPILDISQNSLWARTFETFGEDPY
LASNQTAACVKHFIGYSKTPTGHDRDNVLMSDFDLLNYFMPPFMAAFEAGAHSVMENYIS
LNGNPVVESSKILNDLLRTDMGYEGVLLTDWNEIYNLHDFHRVASTREEAVSSSLQHTSI
DVSMVPSDTDFINYTRSMLDKHPEQEARLRESVKRVIKMKLQLGLYDNPVPGEKYVSMVG
NDKDKQAALNMARESIVLLKNDKDVLPLPKSAKVFLTGHSADNVGYQCGGWTLIWQGHSG
NAMFPHGVSVRKGLEEMVGNDSFTYFNGLMPNGNIADADMAKAVELAGQHEYTVAVIGES
SYTEKPGDIDDPALPEGQEKFIKALAATGTKVIVVLFGGRPRLLGSIPDHAVAIIDGMLP
CELGGQAMAEILYGDVNPSGKLPITYPKDPANIAIPYNHLVTTRCMWDNCWMQWDFGAGL
SYTKFNYSSVTLDKTTIANAGDTLTASVTVTNVGKRAGKETVMLFLIQPYRKISVPEMKM
LKKFKKIELQAGESMDVSFSLSAEDWGVYQPQIGQGLKRIVEDSKYVVAIKPDTWCDVYW
GGAKNPLCAEFTIDTTSGAGTVSAGVQL

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	293	2.9e-45	0.8379629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.19e-110	6	714	9	754	beta-glucosidase BglX.
224389	BglX	3.20e-58	105	413	73	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.60e-50	376	602	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.25e-49	122	681	115	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.90e-40	104	337	78	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	0.0	1	747	1	776
UIZ29613.1|GH3	0.0	1	736	46	822
UIZ29432.1|GH3	0.0	1	736	1	766
CCA27737.1|GH3	3.24e-264	35	733	71	808
UIZ27116.1|GH3	5.22e-257	48	733	1	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	8.33e-109	105	718	89	746	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
6R5I_A	9.47e-75	122	714	89	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	4.81e-74	122	714	89	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	4.90e-74	122	714	90	723	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	8.52e-74	122	714	121	754	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	3.81e-119	35	710	83	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	5.99e-108	105	718	111	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.94e-80	122	714	121	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	2.69e-80	122	714	121	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	2.19e-76	122	717	91	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999738	CS pos: 19-20. Pr: 0.9779

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_337991-t26_1-p1.