CAZyme Information: PHYSODRAFT_337531-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_337531-t26_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		36728.50	9.2677

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159158:1283698-1284746(+)

Full Sequence      

MRFFTPLVVLATFASGALAGFGGGAKCSGPNARVQPPKGAIVVDATGKHPGSYKTVSEGV
ANIPNTTAEHTLFVYPGVYREQVVVPNFNGPIVLQGYTCNTQSYAHNQVTITHSMAQKDL
PANMTGPRNQLVSTMLFKSKNGTRVYNLNVANPQPKIKNLGQAIAVYVDGPKHGFYGMNM
TGYQDTLCANKGPQLYAKSYINGAVDFIFGLLSKSWFESCDIESIGNGSITANGNGNSSN
LSEYVINNARVFGCYNKSAAFLGHPWFPYARVVFQNSELGDVINPKGWDRWNKGNGTANV
YFKEFNNRGPGALDTAVPITDILGDDYKSQWYVDKKFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	42	331	7.4e-65	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	5.18e-39	41	312	13	260	putative pectinesterase
178113	PLN02497	1.29e-38	41	312	34	294	probable pectinesterase
178372	PLN02773	4.30e-35	35	312	1	270	pectinesterase
395871	Pectinesterase	8.83e-34	41	312	2	266	Pectinesterase.
215367	PLN02682	5.35e-33	37	312	67	335	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54875.1|CE8	5.55e-164	1	338	1	346
ACO54874.1|CE8	1.00e-150	1	338	1	348
ACO54872.1|CE8|3.1.1.11	1.34e-148	3	338	4	348
ACO54873.1|CE8	4.91e-148	1	338	1	344
ABQ63096.1|CE8	8.06e-147	1	338	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.55e-48	33	337	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.58e-48	33	337	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	4.25e-24	41	312	9	273	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	3.65e-22	51	312	13	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	8.23e-08	53	312	48	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.54e-65	33	337	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	3.18e-58	33	338	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	5.92e-53	33	329	28	318	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	5.92e-53	33	329	28	318	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.65e-52	33	329	28	318	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999737	CS pos: 19-20. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_337531-t26_1-p1.