CAZyme Information: PHYSODRAFT_336222-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_336222-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: cutin hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		20218.93	5.4985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159157:818459-819061(-)

Full Sequence      

MLVLLANPAHLVNAECSDVHVVFARGSGELPGLGTAGQPLVSTLTSDLGGMSVSSYAVNY
LAAYDQTSAGAGATDMTNHVVSVAQECPNTVFVLGGYSQGASVTDISIGIKTTLGSGSVI
PESQAIVTFGNPLKLFGQTIASSSSTYGPKAIEFCNQGDPVCAAGFNMMAHLMYPTDGSV
TTAAQKAAALVKGGVRALRA

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_336222-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	15	186	3.4e-48	0.9682539682539683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.13e-40	16	193	2	171	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY60079.1|CE5	9.20e-101	4	200	15	215
AAO92431.1|CE5	7.71e-97	5	199	18	222
AAO92430.1|CE5	7.71e-97	5	199	18	222
AAY43367.1|CE5	8.26e-97	4	193	15	208
AAX55266.1|CE5	9.86e-94	1	199	14	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.01e-16	13	183	76	241	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
2CZQ_A	3.40e-14	13	194	3	203	A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2],2CZQ_B A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2]
1CUX_A	2.63e-11	13	177	28	194	Chain A, CUTINASE [Fusarium vanettenii]
2AXE_A	3.15e-10	15	177	1	193	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1BS9_A	5.98e-10	15	177	1	193	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6WFI5|CUTI_KINRD	2.62e-56	14	192	34	219	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1
sp|P0A537|CULP3_MYCBO	1.91e-36	16	197	44	228	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP39|CULP3_MYCTU	1.91e-36	16	197	44	228	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1
sp|P9WP38|CULP3_MYCTO	7.52e-36	16	165	44	198	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1
sp|P9WP42|CULP1_MYCTO	5.31e-35	16	188	35	210	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.787268	0.212750

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_336222-t26_1-p1.