CAZyme Information: PHYSODRAFT_335255-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_335255-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: flavodoxin/amb allergen/pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		38181.43	7.6527

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159156:2093647-2094829(+)

Full Sequence      

MKFLRPVLVAVVALVFQTSEAFTVGSATGLAAGTTGGGSATPVYPTTTAQLVAYLKDSVP
RVIVLNKTFDFRGTEGTTTEAGCRPDYTRACIAKNNGYKSQDVILQSGGMSNTGGCSDGT
SVTVTYDNAAITPMTVTSNKTLGGIGTTGVIMGKGLWLNGDNIIIQNVHITELNRHLFLT
TNAASVSTMTISNSDFDGRTDYSATCDGRHYWSFIFYGANTRFSMLNNYIHSTSGRSPKL
GGDSSANVVAHIANNYWADNSGHSFEVGVNAWILAEGNYFEDTTAPLLSGSDGYMYAATA
TTECSSYLGRSCAANVVDNSGPFGSRSGSTALSKVKSYSAISGYSPRSAKQWSKTTSNFG
IN

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	178	282	2e-40	0.5454545454545454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.08e-18	122	283	2	189	Amb_all domain.
226384	PelB	3.12e-08	97	323	51	314	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74068.1|PL1_4	1.96e-232	1	361	1	396
ADN18834.1|PL1_4	2.08e-227	1	361	1	396
ADN18833.1|PL1_4	8.92e-180	1	361	1	396
ACR19248.1|PL1_4	6.45e-163	42	361	133	487
AHX74066.1|PL1_4	2.50e-143	10	361	10	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	5.11e-69	24	360	4	358	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.95e-65	25	323	5	321	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.33e-63	25	323	5	321	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA61|PELB_EMENI	1.10e-75	1	323	1	341	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|B0YCL3|PELB_ASPFC	2.76e-75	13	349	12	369	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2
sp|A1CFS2|PELA_ASPCL	4.25e-75	10	323	8	340	Probable pectin lyase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=pelA PE=3 SV=1
sp|Q2TXM4|PELA_ASPOR	4.88e-74	25	323	24	341	Probable pectin lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelA PE=3 SV=1
sp|Q0CYL8|PELA_ASPTN	2.65e-73	1	325	1	342	Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000198	0.999747	CS pos: 21-22. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_335255-t26_1-p1.