CAZyme Information: PHYSODRAFT_334881-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_334881-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512		55175.61	4.5533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159156:939165-941911(-)

Full Sequence      

MGTEVSMESSTTPATHVARADSPHLSDPEWEALQRLSTVIGDAAVATMLRTLTPTEQDGV
ALGFIMREQRDAASSTTVSSGTTIAQAQFGTNIPEKHPALASQVCTKVTNVLAQVDHMDS
DVVECVTEESSVVIDANWRKMANGEWNSTTCSTPKECAKICGLEGADYAGKHSITTSGQT
LNMKLETPGGVGTHVYMLEPSGKKYKQFQLLNQEFTFDVDMSSLPCGSNDALYFSKMDAD
GGTSRFPINTAGAAYGTGYCDAQCMKDVKFINGEANMEKAYGACCTEMDIWEANSMATSY
TTHPCSIDGQQRCSADEDCGATEANRYSGWCDKPGCGLNPFRMGNKKLYGRGKEFDIDTT
RAFTVVTQFITEDNTETGELVEIRRLYKQGARVVANPGSTWPALNGTDSITETMCKSSKA
FFGDHPYAVGGLAQMGKQMIGGMTLAMSIWVDYGSNMAWLDSYKTGQDPSVPGALRGDCP
NPGGDPESVFAESPDATVKFMNIRSGDFRSAY

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	88	512	3.4e-135	0.9951807228915662

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395677	Glyco_hydro_7	0.0	90	510	2	433	Glycosyl hydrolase family 7.
153432	GH7_CBH_EG	2.04e-163	94	506	1	386	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25851.1|GH7	1.21e-163	84	512	22	464
CAD79798.1|GH7	2.84e-139	74	512	10	454
QES86349.1|CBM1|GH7	1.03e-135	72	512	4	453
BAD16575.1|CBM1|GH7	9.67e-135	88	512	20	450
BAA76364.1|CBM1|GH7|3.2.1.176	2.06e-134	88	512	20	450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GPI_A	3.01e-133	88	512	2	427	Chain A, EXOGLUCANASE I [Phanerodontia chrysosporium],1H46_X Chain X, EXOGLUCANASE I [Phanerodontia chrysosporium],1Z3T_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3V_A Chain A, cellulase [Phanerodontia chrysosporium],1Z3W_A Chain A, cellulase [Phanerodontia chrysosporium]
1Q9H_A	8.34e-132	88	512	2	434	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
2XSP_A	4.90e-126	88	512	2	438	Structure of Cellobiohydrolase 1 (Cel7A) from Heterobasidion annosum [Heterobasidion annosum],2YG1_A APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum],2YG1_B APO STRUCTURE OF CELLOBIOHYDROLASE 1 (CEL7A) FROM HETEROBASIDION ANNOSUM [Heterobasidion annosum]
4CSI_A	7.59e-125	95	510	9	432	Chain A, CELLULASE [[Humicola] grisea var. thermoidea],4CSI_B Chain B, CELLULASE [[Humicola] grisea var. thermoidea]
4V1Z_A	1.26e-123	88	512	2	437	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P13860|GUX1_PHACH	3.66e-136	88	512	20	445	Exoglucanase 1 OS=Phanerodontia chrysosporium OX=2822231 GN=CBH1 PE=2 SV=1
sp|Q4WNA2|CBHA_ASPFU	1.24e-131	88	512	19	450	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhA PE=3 SV=1
sp|B0Y793|CBHA_ASPFC	1.24e-131	88	512	19	450	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhA PE=3 SV=1
sp|A1DMA5|CBHA_NEOFI	4.95e-131	88	512	19	450	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=cbhA PE=3 SV=1
sp|A1CE97|CBHA_ASPCL	2.90e-130	82	512	13	450	Probable 1,4-beta-D-glucan cellobiohydrolase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=cbhA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_334881-t26_1-p1.