CAZyme Information: PHYSODRAFT_332350-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_332350-t26_1-p1
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	JH159154|CGC1	50431.49	7.2421

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:6261316-6262833(-)

Full Sequence      

MCPHVLLVEASEACAYCGNDQSGPNCCVSGNYCQPWNPTYYQPANARQLPDDCCNRCAST
SGCAAYTFVNNGWDGQPHCYLKRGTGTRKKAVGAVSAVVSSSSSSRPRATNTTDGGHIQV
QIRSGAVQSKAVNLGGWLLTEHWITWESALWNGISADEDHKGEYHTMQLQGKEKGTAAFE
QHRKTWITEADIKEIAETGVLNTVRVPVGHWIIRDATTAPGTEGDMYARGGLKYLDALIN
NWAVKYNVAVMISLHAHQGSQNGIEHSAPVTLGNVGWSTSQTNVDNSLKFATFLAARYKN
SPAFLGLNRMNEPVPFVDGNVLRNYYIQAYKQIRATGNDCIRLVTPFLSEQDPEHLKGMI
GAPEYTNAWTEIHAYFIWGYEGKTEEQVLAVIDQGIFQNIDNFRELGRKQLAYYNADTTG
GWAFWAWRNSDETVKRTGWSMRYLIRNGYLKLTA

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_332350-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	180	378	4.1e-37	0.6750902527075813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.95e-20	179	339	66	217	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
405052	PAN_4	2.94e-08	50	82	18	51	PAN domain.
128519	APPLE	6.96e-07	48	88	22	64	APPLE domain. Four-fold repeat in plasma kallikrein and coagulation factor XI. Factor XI apple 3 mediates binding to platelets. Factor XI apple 1 binds high-molecular-mass kininogen. Apple 4 in factor XI mediates dimer formation and binds to factor XIIa. Mutations in apple 4 cause factor XI deficiency, an inherited bleeding disorder.
395098	Cellulase	7.13e-06	186	427	24	268	Cellulase (glycosyl hydrolase family 5).
238533	APPLE_Factor_XI_like	1.01e-05	48	90	25	63	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29723.1|GH5	2.62e-101	121	452	4	362
AAM18484.1|GH5	6.34e-101	118	452	9	370
CCA15861.1|GH5	1.30e-91	119	454	13	376
CCA15900.1|GH5	8.83e-90	117	452	101	454
UIZ29004.1|GH5	5.65e-82	112	445	31	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	2.25e-28	130	448	10	376	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	3.34e-28	130	448	16	382	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	4.20e-28	130	448	10	376	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.57e-28	130	448	16	382	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	8.42e-28	130	448	15	381	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12626|EXG_PICAN	1.29e-32	132	450	52	419	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|P29717|EXG1_CANAL	2.04e-27	130	448	54	420	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q96V64|EXG_BLUGR	1.14e-26	130	375	38	270	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	3.62e-25	126	411	26	285	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q12725|EXG_YARLI	3.73e-24	125	423	33	315	Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=EXG1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.982492	0.017546

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_332350-t26_1-p1.