CAZyme Information: PHYSODRAFT_329957-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_329957-t26_1-p1
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		34349.20	10.0681

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:8702584-8703706(-)

Full Sequence      

MQSMLFWRRQPFSVLDPSVPTKRNSFLSTITRGSLRSWIDITYDKAATNPLIVGSNKTLV
GEGSKGVLNGKGLMITGSNVIIQNIHITNLNPHLVWGGDAITIRGNGNVAPKGIWIDHVK
ISNIGRQMIVTNFSGVQGFTIKDGFGNYIHHTSGRSPKVGGHSGETTVIYAANNYFYDNT
GHAFDVSTGGYALAEGNYFEAVIGRDCKPNVVTKSGALKGNSQGKGSQFVNVKSLINQYK
VTAATKLAVGAGNFGVGSLGSTAAQSDPIQQSSSSQGNNSAAQSNPTQSSAESSAYSSAD
QSSPIQSSASQSTPSPVEQTDGNRKL

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	41	142	3.3e-40	0.5187165775401069

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.44e-30	40	203	1	190	Amb_all domain.
226384	PelB	2.53e-09	53	200	99	274	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.12e-05	44	199	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19253.2|PL1_4	4.82e-97	39	261	128	406
ACR19250.1|PL1_4	1.31e-85	39	277	285	577
ACR19256.1|PL1_4	2.38e-83	37	202	123	319
ACR19247.1|PL1_4|4.2.2.10	3.39e-62	39	259	122	398
ACR19251.1|PL1_4	3.39e-62	39	259	122	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	6.30e-41	34	229	77	333	Pectin Lyase B [Aspergillus niger]
1IDK_A	4.91e-39	39	253	92	358	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.64e-38	39	202	92	279	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	8.34e-51	39	274	112	400	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.82e-45	42	269	117	393	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	1.82e-45	42	269	117	393	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|Q0CFF7|PELF1_ASPTN	1.80e-44	37	202	107	301	Probable pectin lyase F-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-1 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	2.07e-44	39	202	111	298	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_329957-t26_1-p1.