CAZyme Information: PHYSODRAFT_325998-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_325998-t26_1-p1
• CAZy Family: GH10
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714		77570.56	4.8901

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:6738078-6740378(-)

Full Sequence      

MLGYWLIAACCTALSLAAGAATDDLDARAAVIVENLSPDEVVGQLTQISINYMLNEDYSL
NEEVVRTFANLHVGSFLVSPFVTSPNAITGEAGWNATKWRSNIARIQGIVMEENNGVPMI
YGLDSVHGAGFVLNATLFGAQINAAATFNPDLVCNMGLISAQDTLAAGQPAVAAHLRDVR
VDTYLVTVMSESLIRGLQANNQTAACMKHFVAYSKTPTGRDKDGTQLSDFDLLNYFVPPF
KAAIAAGVKTAMENYISINGVPVIGNHKILQQLLREDLGFTGLTVSDFDEFGDYSTAHRI
ARNVNESIRFSYNLTGIDMSMAYDTKYLNATKALLEQSPEYLDRLKESAHRIINTKLQNN
DSTLPIPSSSTIFLTGHSAHNIGNQCGGWSVRWHGYTGNEYFPNGISVKEGLEAFAGDKV
TYFNGLNADGIYSDANLTTAKRLAIRLKKTGDLDDLALPAGQVEYVKELASSGSKVILVL
FEGRPRLLGGLPAHVHAVINGILACEQAGKALAEIIYGHVNPSGRMPITYPKDAANILMP
YNHRVSTRCADNEYCEMQWDFGAGLSYTNFTYSDLVLSRTTVTSSSDTIDVSVTVTNSGS
VVGKETVMLFITQPYRSISVPEVKQLKKFSKISLEPGQSQHVYFTLTADDWSVYYPQIGQ
GLKQVAEDADYVVAINPETDCDVYNETAAANPLCATFTLQTGEYPYGSFLSVAN

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	321	5.4e-38	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.85e-83	17	675	23	750	beta-glucosidase BglX.
224389	BglX	6.69e-38	36	392	1	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.90e-31	39	354	3	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.08e-29	357	567	4	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.01e-29	124	646	89	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	1.41e-242	1	699	1	762
UIZ29432.1|GH3	9.98e-223	1	705	1	769
UIZ27116.1|GH3	9.75e-220	45	700	1	725
CCA27737.1|GH3	7.90e-219	28	699	67	808
UIZ29613.1|GH3	7.26e-218	1	705	46	825

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.07e-83	33	650	21	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
6R5I_A	4.98e-58	97	675	52	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.40e-57	97	675	52	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	2.43e-57	97	675	53	719	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	3.59e-57	97	675	84	750	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.92e-88	32	675	83	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.40e-82	33	650	43	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	1.94e-59	113	682	61	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	2.53e-56	26	679	35	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	1.20e-55	26	679	35	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999739	CS pos: 19-20. Pr: 0.9471

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_325998-t26_1-p1.