CAZyme Information: PHYSODRAFT_321717-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_321717-t26_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1024	JH159151|CGC13	113162.63	4.5727

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:5172096-5176653(-)

Full Sequence      

MSLRKLKWRGIGRLELLAWINDFLETDYTKIEHLADGIAYCQIFDALYPGKVNLQKLNFH
ARTEMEFERNLRVLRRTFHLCEIKKEIPIRKLIQGVFQEHFEFLHWVHDYAHKTCPDAVR
SYHGFERRQEALRQSFSQAKSNTTNTNLIPKYSNSMKAPCELYIGAFAPGTEEFEDASSS
AEQPTSAEVSEEEDGVLAPDGGEELDGMDPALRVIRPRELPVQQLTFQLTRDLAPGNTAV
TAIAKARKMFKMWLSALCCTALGLVAEAMADDFDAQAEAIVASFTTEQVLGQMAQIPIYS
FMNADNTLNETLFRNYAKLKIGSYNLIPFNDATNDVTGEYGWTAPEWRKVITRIQEIAME
ENDGVPMIYALDSVRGANHVMNTTMFGAQINAGASFNPDLVYKQGVITGQDTRAAGISWI
MGPVLEISHNPLWPRTFETFGEDPYLVTVMAETITRGLQSSNETAACLKHFVAYSKTPTG
HDQDGVAISDYDLLNYFLPPFKRSMEAGALSTMENYISVNGVPTIANNRILQVLLREDIG
FDGVALSDFGEIGMMNTFHRVARDTNEAVRFSYTHTGIDMAMGSDTAYLNGTTVLVEESP
EYLDRMKETAKRVIKMKLKLGLYDNPVPGADDVAKVHSEEDIATALELARESIVLLQNND
STLPISTSASVFLTGHSAHNIGNQCGGVSIWWHGCSGNDNFPNGISVKEGMEAIAGSDKV
TYFNGLDSDGNYSEANMTTAKQYASQAEYTIAVIGEHPYAEKTGDLDDLALPAGQIEYVK
ELASTGTKVIVVLFEGRPRLLGDLPENVHAVVNGLLACEQGGKAMAEIIYGQVNPSGRMP
ITYPKDAGNILIPYNHRVSTQCADSEYCEMQWDFGTGLSYTDFTYSDLTLSKTNVTSSSD
SIDVSVVVTNSGSMAGKETVMLFLTQPYRSISVPEVKQLKKFSKISLEAGASQTVNFTLT
ADDWSVYKPQIGEGFKQVAEDTDYVIAIKPETDCDVYNETAAANPLCATFTLQTGEYLYG
VFLE

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	360	582	6.1e-56	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.42e-104	343	980	85	742	beta-glucosidase BglX.
224389	BglX	1.17e-59	364	691	59	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.60e-42	380	959	108	742	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	5.35e-42	653	880	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.33e-41	351	614	51	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	1.67e-298	249	1013	1	763
UIZ29432.1|GH3	3.04e-276	249	1013	1	764
UIZ29613.1|GH3	5.26e-276	249	1013	46	820
UIZ27116.1|GH3	5.70e-270	293	1013	1	725
CCA27737.1|GH3	1.09e-268	278	1013	69	809

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	5.48e-109	285	963	25	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
7EAP_A	2.98e-80	280	966	21	726	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5YOT_A	2.98e-80	280	966	21	726	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5XXL_A	6.85e-76	264	988	1	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.31e-75	264	988	1	737	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	8.31e-115	280	988	83	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	3.96e-108	285	963	47	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.42e-78	365	971	104	737	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	1.60e-78	349	995	49	713	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	5.05e-78	348	971	86	737	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_321717-t26_1-p1.