CAZyme Information: PHYSODRAFT_319793-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_319793-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528		58439.59	4.4430

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159164:887015-888601(+)

Full Sequence      

MKVLTAIAGAASLASFALAEPSWHNLTITAPQYGRYLYRTESEEPFFWKADTAWELTHRL
NKTSIDFYLKTRAEQGYNVVLSVVLSAYNGTTRPNFYGDLPFNNGDTTQFNESYFELIDW
TVDLAASYGILMALVPAWGNWISGAWHGTKESLFNDSTAYEWGKYVGERYPGLPKILGGD
TNCFWVRNTTAAMISYAESPTVDPATLLGPVEDTTHLWLSMRSGVKDAESAQGYEPVILF
HPTAGNIDRPVQTPEAYGHLQFPKEEDRVSIDAVQSGHATPEALGGFTPYKTWDSTKNYE
LIAAMRDGFTGPVLDLENHYEGAHDNLDASVAMIWNASQVRTGLYNNVYAGAAGFTYGAN
SVWQMYEPAVNLLRESDYYSPSSGENASSSWRKDLFFEAGQQAQYVTKPLQNLSVAQLEQ
LEPARQLLASPSGYTDVAVNAFGSTRFISVLASETRDRFYVYTGHGDSFSLELGNGSERS
GTARWFSPRDGEFHSDSTVNVPANATHVDFTPPSGGTVDDDWLLVLEF

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_319793-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	34	523	4.6e-75	0.9757281553398058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	6.48e-113	34	413	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.40e-10	455	527	21	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	3.28e-147	23	527	28	534
KAF3763706.1|GH140	4.20e-139	2	526	3	535
KAE8313632.1|GH140	2.40e-72	28	527	29	508
KAB8203844.1|GH140	1.81e-71	28	527	29	508
KNX49908.1|GH140	4.43e-71	25	523	13	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.55e-24	23	526	13	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	7.26e-23	23	526	13	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYSODRAFT_319793-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000636	0.999342	CS pos: 19-20. Pr: 0.9734

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_319793-t26_1-p1.