CAZyme Information: PHYSODRAFT_319786-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_319786-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		51057.41	4.6389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159164:855182-856768(+)

Full Sequence      

MKLQAALAGLLFASTASADPSWHDLTITAPRYGRYLTRTTSGEPFFWQADTAWELTHKLN
KTSIDFYLKTRAEQGYNVVQTVVIAELNGTTRANFYGDLPYNNSDTTQPNDAYFQLIDWT
VDLAASYGILVALVPVWGRWVNGGWHGDEVSIFNESTAYEWGKYIGDRYPGLPKILGGDS
DCIWARNTSKAMVSYAADPNVDPATLLGPLEDTTDIWVSMRAGVKDAETAHGYEPVILFH
PTAGWISRPENTPEAYGHLMLPKEEHRVSINGVQSGHATPDALGGFTPYTTWDSTKNYEL
IAKMRDEFTGPVLDLENHYEGAHDNFKMAFPIWNASEVRTGLYHGVYGGAAGFTYGANSV
WQIPSGHDDVSVNAFEGTRYISVLASENCDRYFAYTGHGDSFSLKLSNGSERSGSARWFS
PRDGQYYANSTVSVPASGNGTRVDFTPPSGGSVDDDWLLVVEF

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_319786-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	33	368	1.2e-62	0.6796116504854369

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.27e-106	33	362	2	279	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	3.80e-10	377	462	12	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	1.91e-139	13	462	20	534
KAF3763706.1|GH140	3.87e-130	3	461	8	535
KNX49908.1|GH140	6.24e-70	33	461	22	517
KAB8276359.1|GH140	3.04e-61	1	462	1	508
KAB8225539.1|GH140	2.27e-60	24	462	26	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.05e-25	22	461	13	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	8.76e-25	22	461	13	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYSODRAFT_319786-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000448	0.999544	CS pos: 18-19. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_319786-t26_1-p1.