CAZyme Information: PHYSODRAFT_318325-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_318325-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	JH159159|CGC2	42687.96	6.4226

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159159:1023235-1024374(+)

Full Sequence      

MCPAIAQKLRARVQQEFEIAKTSLTINPAFLELWRHNLFVASADNPFIIGYTPESSYASI
VFECIFKTILEHHGRPILVVSEKALHVNYQNHPDVFIFSIFDADCDPMSNPGCPEMIAHY
MDQYLLPVDSSSKLMMISGEAIDTQALDDRVPLLSSVSSVTRTQHVYLPVVSISFAERLQ
HIPLDLLTPAPPDPISRRFCAYLYARCERPHRERMFDLLNALEPVDALGICAGSSRPPDK
AYKASRYFKWFNDEAIASYQRYKFVVAFENSAEPGYVTEKLANPLLAGSIPIYLGNSTTA
SELFNPDSYIDCGRFGKLEECAEFVVRVHNSPELYAKMRNAPPIRNMTAFTEAFSWHPSV
PSRGLADKVAKMLFLNTSK

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_318325-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	195	341	6.2e-34	0.3919308357348703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	7.26e-17	211	337	17	132	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEJ34901.1|GT10	9.69e-20	155	342	36	211
BAV61775.1|GT10|GT25	1.25e-19	117	342	353	566
QTF49584.1|GT10|GT25	1.25e-19	117	342	353	566
AKI81328.1|GT10|GT25	1.25e-19	117	342	353	566
BAV62761.1|GT10|GT25	1.25e-19	117	342	353	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	5.38e-14	193	347	176	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	3.87e-13	193	347	176	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	2.23e-20	117	342	353	566	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q9C8W3|FUT13_ARATH	3.07e-14	205	337	222	359	Alpha-(1,4)-fucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=FUT13 PE=2 SV=2
sp|O30511|FUCT_HELPX	4.11e-13	193	347	176	316	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
sp|Q6A1G2|FUT11_XENTR	6.06e-11	202	337	253	389	Alpha-(1,3)-fucosyltransferase 11 OS=Xenopus tropicalis OX=8364 GN=fut11 PE=2 SV=1
sp|Q68FV3|FUT11_RAT	1.01e-10	202	337	214	350	Alpha-(1,3)-fucosyltransferase 11 OS=Rattus norvegicus OX=10116 GN=Fut11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999829	0.000184

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_318325-t26_1-p1.