CAZyme Information: PHYSODRAFT_315540-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_315540-t26_1-p1
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	JH159155|CGC7	39222.05	3.8376

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159155:1376852-1378106(+)

Full Sequence      

MVNVLPCFKCTGINYNIRAGPDWATADVKCKPASQIATELATLKGVTDTIRLYSLTDCDQ
ATAVVPAAIEAGLKIELGMWVDSAASSFEAEKAAFQTLLETGVVTADNTVGIHVGSEAVY
RGDVTAAEAISNLNEIRTLCQANSGAAAIPLTIADIGDTYSAHPEMIEAVDYVSANYFSF
WEKVAIDGAAEHFYERFSALVEIASGKQVIVGETGWASDGVDADASPATAENAAKYFHDF
YTLAAEKDLMYFYFSAFDEPCKLATLEANETVEAYFGLFTQEGALKDLISAEFANATASF
DGSDSATITAVGADSSASASAAAGAVTTGDATQDGETTSAVDASSDEETASGNGEDDSTT
QTSTATTPSSRKDCAM

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_315540-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	27	286	1.1e-22	0.9517684887459807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.16e-42	26	282	55	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.58e-16	12	286	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ90910.1|GH17	8.27e-187	8	307	26	327
AAM18482.1|GH17	9.26e-160	8	312	26	333
UIZ28880.1|GH17	7.36e-157	8	307	14	315
AIG56195.1|GH17	7.10e-70	12	286	22	304
AIG56146.1|GH17	8.94e-69	8	311	20	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.82e-34	12	292	39	295	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	3.51e-33	12	292	39	295	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15703|BGL2_YEAST	9.19e-30	27	293	37	312	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|D4B2W4|BGL2_ARTBC	1.03e-25	27	282	34	292	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|P43070|BGL2_CANAX	7.15e-25	27	293	32	307	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	3.56e-24	27	293	32	307	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|Q0CI96|BTGC_ASPTN	1.04e-23	23	287	359	642	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_315540-t26_1-p1.