CAZyme Information: PHYSODRAFT_313849-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_313849-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	JH159153|CGC2	38623.23	4.1005

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:7794031-7795175(-)

Full Sequence      

MFLKAVLFFGGICAATTLDTASALTKGHDLSSVGLMETSQGANWISTSGNTTTIESILGA
GGMDAVRLRLWTSGDYDLDYTMALAQRFSKAGYKIYLDMHFSDTWADPTAQAIPSSWDAS
SVTTLAADIQAYVTSTLKSFTDGGVDLEILSLGNEISGGFLFPTGKISDNDFSNFATLWK
AARQGVTDAVSAGSKQPKIMIHLENGWKSTTVSSFFKGLFAEGTVTTDDVDVFGFSFYPF
YNTAATIDALTTSLTQLANTYNKPLYIAETDWPTECTKVTLSADYPVNAEGQREWVIAVM
DALNGLPNNLGAGIFYWEPGYLSVAGLGSSCESALLFSVNWDNWPETYATALSSVNMFA

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	26	340	1.3e-78	0.9649122807017544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	5.26e-86	26	358	2	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	9.44e-58	26	349	41	371	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
381626	GH113_mannanase-like	2.84e-04	228	317	178	279	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO16178.1|GH53	4.77e-101	21	358	34	394
USW53574.1|GH53	4.96e-96	26	358	29	386
CCA76188.1|CBM1|GH53	1.96e-92	19	358	86	420
ATZ54814.1|GH53	7.03e-91	21	358	25	379
CCD47618.1|GH53	4.00e-89	21	347	25	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BF7_A	1.25e-76	17	341	13	335	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1FHL_A	6.52e-75	23	350	1	330	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
1HJS_A	2.17e-72	23	358	1	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	4.27e-69	26	358	5	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1R8L_A	3.17e-32	26	349	26	352	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y7F8|GANA_ASPTU	7.59e-80	12	347	6	343	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
sp|Q8X168|GANA_ASPNG	8.54e-79	12	347	6	343	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1
sp|A2RB93|GANA_ASPNC	4.81e-78	12	347	6	343	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=galA PE=3 SV=1
sp|Q5B153|GANA_EMENI	6.06e-76	17	341	13	335	Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=galA PE=1 SV=2
sp|P48842|GANA_ASPAC	6.06e-76	7	350	1	346	Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus OX=5053 GN=gal1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000297	0.999660	CS pos: 23-24. Pr: 0.9540

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_313849-t26_1-p1.