CAZyme Information: PHYSODRAFT_313518-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_313518-t26_1-p1
• CAZy Family: CE5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		59118.90	6.7827

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:6069755-6071599(-)

Full Sequence      

MPTSVVLQLVTEFDYIIVGGGSAGCVLANRLSADSSNSVLLVETGPKDRGLLDSIRLAMP
AMLTANLIDERYNWNYVTEPQKNLNGRRLTWPRGRVLGGSSSINAMIYNRGHALGYEDWK
NSGAAGWGYADCLPYFKKAQTHALGADDYRDQPLYQTFLDAAVQAGYPFTEDVNGYQQEG
VGSSASAAYLTDSVLSRENLTVLTDTFVNKLVFEGKRAVGVEVEPFKKSGDQVPRRIRAA
KEIILSGGAVNSPQLLMLSGVGDAQHLKEVGVPLVHHLPAEHLGVYLHVKCKKPITLYHA
TPHFPHEMAWMGLQWLTSKTGAGTSSHIEAGGFIRSAPGKRHPDLKWQFVPGASDKDRQL
LLDGHAMMLHCTTLRATSRGFIKLRSADPRASPIIEPNYLDTETDRVDLRNGVRLTREVL
QQQAFDEFRGDAVSPSDLVQSDSEIDAWVRQHASTDYHPSSTNRMGLESDANTVVDSQAR
VHGLEGLRVVDASIMPNNVSGNLNAPTIMLAEKAADMILRQSSAAHVIAPISDFFYVCPK

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_313518-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	520	5.1e-142	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	0.0	12	531	5	544	choline dehydrogenase; Validated
225186	BetA	2.35e-155	12	525	7	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.56e-49	85	278	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.47e-42	377	514	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.57e-25	13	521	56	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	5.44e-238	8	519	23	558
CAB3230510.1|AA3_2	1.80e-183	12	518	24	555
ANI26486.1|AA3_2	5.93e-175	2	531	60	614
AWP09430.1|AA3_2	1.66e-172	11	531	18	563
CEF60566.1|AA3_2	5.90e-141	15	519	35	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	1.94e-80	12	518	7	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.94e-80	12	518	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.94e-80	12	518	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	2.84e-80	12	518	23	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	3.81e-80	12	518	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NE62|CHDH_HUMAN	1.07e-178	12	521	40	574	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q6UPE0|CHDH_RAT	2.52e-178	12	518	45	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	2.61e-177	12	518	42	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q9L4K0|BETA2_CHRSD	7.82e-151	11	518	5	533	Oxygen-dependent choline dehydrogenase OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	4.89e-149	11	530	3	542	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000006

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_313518-t26_1-p1.