CAZyme Information: PHYSODRAFT_308343-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_308343-t26_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	JH159151|CGC11	56279.24	8.9833

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:290150-291818(-)

Full Sequence      

MADVVTYDWRLTPIMTAFDGVRLQTLGVNGKPSHEAVIEVQLGQEVKVHVTNKLSEPTCL
HWHGMKQLGTQEMDGMCGISQCAIEPNSSATYRYTPDKAGTFWWHSHHGTQYAYDLRGPL
IVNGPDTKAKKLWDHEYTIQMAAIYHAPPPPGPPLSTFDFVLGRKYLLRVINMAAMGTFE
FTIDGHEFQVIAADAEPVAPTKLLNSIIVNVGQRYDIIVQAKKDTRGVRSFWMRAKGLTG
YPWTARTASTGTAGFNEEGLAIVRYDSRSSSAEPTTQKAKTTPDDRSYMRFNINTTIGTG
IVSLDGGEFQTLVVPDEPPLLSIASGLTTAELPRSANARAIRYGDHVEVVLRNDVIEQRP
FHLHSHVAWVVGSGHASAQDVYNNKLPAPKLKGAMMRDVYTVPPCEVDAKGVCVIVGYVV
LRFKADNPGVWMMHCHVDWHMAIGMGMVFVEGEAELPKKGPKAFSSSLLSVCKNKSTGGD
VVKAYSNGYRSSTARNYRGSKKSTKSSKSSAK

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_308343-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	154	445	7.5e-44	0.5251396648044693
AA1	25	147	1e-36	0.3590504451038576

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	5.40e-58	4	459	1	534	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
225043	SufI	1.34e-53	19	454	48	451	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
215324	PLN02604	4.86e-50	28	452	48	547	oxidoreductase
177843	PLN02191	3.50e-47	2	452	21	547	L-ascorbate oxidase
274556	laccase	2.98e-40	26	457	25	525	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFY09916.1|AA1	8.84e-185	2	472	23	544
UIZ26488.1|AA1	1.56e-173	2	472	14	536
AFY09915.1|AA1	1.40e-160	2	477	19	570
UIZ26495.1|AA1	2.02e-154	1	472	20	561
AIG55536.1|AA1	1.50e-74	3	467	39	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3V9E_A	7.78e-55	19	459	82	550	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]
3SQR_A	2.07e-54	19	459	82	550	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]
1HFU_A	9.51e-52	11	454	11	471	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	9.69e-52	11	454	11	471	Chain A, Laccase [Coprinopsis cinerea]
5Z1X_A	2.14e-49	37	480	35	494	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12570|LAC1_BOTFU	5.45e-59	19	472	77	542	Laccase-1 OS=Botryotinia fuckeliana OX=40559 GN=lcc1 PE=2 SV=3
sp|J5JH35|OPS5_BEAB2	1.31e-56	7	456	76	556	Oxidoreductase OpS5 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=OpS5 PE=1 SV=1
sp|Q96WM9|LAC2_BOTFU	2.00e-51	19	456	83	548	Laccase-2 OS=Botryotinia fuckeliana OX=40559 GN=lcc2 PE=2 SV=1
sp|Q12729|LAC1_PLEOS	4.14e-51	37	451	67	498	Laccase-1 OS=Pleurotus ostreatus OX=5322 GN=POX1 PE=2 SV=1
sp|K7NCS2|FETC_EPIFE	3.60e-50	2	473	20	515	Iron transport multicopper oxidase fetC OS=Epichloe festucae (strain E2368) OX=696363 GN=fetC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_308343-t26_1-p1.