CAZyme Information: PHYSODRAFT_307158-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_307158-t26_1-p1
• CAZy Family: CE2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	JH159164|CGC2	56512.43	4.2376

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159164:168672-170576(-)

Full Sequence      

MTPHNLIPAGYFYSDDDLLNRIWYAGAYTVQLCTIASNESRANPPTITEYGWFNNATIQN
VTTGAEVYVDGAKRDRTPWPGDFGVSTLSKVVSLNGDNLLSVRHAINSLYAIQNTTNGQF
AYAGTPIAPRVQLAGINSDTYHIWTLIALADYATLTADTEFVENLWDQALYGFEFILGNV
DTSDMLLNVTGVYDWGRVGQGDKNIAANSLLYHALYSYAELAPQLGLEVPSSNGTAFGEL
ASAVKTAVNSNLWDDSAGLFRDNTTAAGGELHPLDGNSLAVRYNLTQSSEQAATVSENLA
TRWNEYGAVSPEGLGSISPFITSVEVEAHLRATPGNASLALEIIRRQWGYMLKAFSNSTT
IEAYYETGELMYPFYGLELGGYISHAHAWSTGPTASLTLHVGGLSPVTDAGKTWEFVPHA
AGADVGELHTGYTMATGDFSVEWTTKNEDSFFFANLETPHNTTGSISVPTFGKSLDSIDI
SINGNTVWANGAASWSGFGAPSGSADFVTVAEVPYGGWFSIVAKDA

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	8	467	3.8e-63	0.7837301587301587

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	6.29e-10	9	389	3	328	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
224541	TreA	5.90e-04	193	365	334	518	Neutral trehalase [Carbohydrate transport and metabolism].
225942	GDB1	0.003	144	319	343	521	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARH52639.1|GH78	1.23e-105	10	469	193	631
QIY67891.1|GH78	4.19e-105	9	497	192	648
QRD03625.1|GH78	1.58e-104	10	469	179	623
QQM46596.1|GH78	1.60e-104	9	518	192	670
CAE7020670.1|GH78	1.85e-103	10	469	180	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.02e-07	10	422	302	657	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYSODRAFT_307158-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999937	0.000106

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_307158-t26_1-p1.