CAZyme Information: PHYSODRAFT_299401-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_299401-t26_1-p1
• CAZy Family: CBM13|CBM13|CBM13|CBM13
• CAZyme Description: putative beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		47462.82	4.4208

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:7792187-7793574(-)

Full Sequence      

MFARRTLLGAAACASALLVDGVQALVKGHDLSSVAVMEKEQGTVWYNTAGKQAAIEDILG
AGGMDSVRLRIWTGEEYALNYTLPLAQRFSKAGYKIFLDMHFSDTWAQPSDQQTPSAWDA
SSVDTLAKACREHVSSTLKAFTEGGVELDILSIGNEITNGFLYPTGKIGKDFGPFAKLWK
AARDGVSDAVAAGTKQPKIMIHLDNGWESEVVSWFFKGLFAEGTVTTDDVDVFGFSYYPY
YNVNATLKALTESLTQMANTYKKPIYVAETDWPTNCTTVTLSEKFAVSARGQREWVMAIM
DVLEGLPNGLGAGIFYWEPGYISVPGLGSACGSNLLFSVNWDNWPDTYAKALSSVYMFAE
EGSGQGSNAQQSQSTPTATPGATPAPQTQTDSSQQKQINFSQLNQSSSGSSRQSDGSSTP
QTAENPVQQTEDDSVVQQQ

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	26	335	1.6e-79	0.9239766081871345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	5.68e-89	27	340	2	323	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	3.50e-62	19	363	32	398	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO16178.1|GH53	5.72e-96	27	358	39	394
USW53574.1|GH53	6.30e-96	27	358	29	386
CCA76188.1|CBM1|GH53	2.45e-95	27	358	93	420
ATZ54814.1|GH53	8.54e-88	27	358	30	379
AAQ77827.1|GH53|3.2.1.89	1.66e-86	27	340	22	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BF7_A	3.67e-76	27	356	22	347	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1FHL_A	2.91e-73	27	342	5	322	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
1HJQ_A	4.07e-69	27	358	5	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1HJS_A	1.60e-68	27	358	5	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1R8L_A	9.37e-38	15	349	10	352	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y7F8|GANA_ASPTU	9.39e-82	27	360	21	349	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
sp|Q8X168|GANA_ASPNG	3.73e-81	27	360	21	349	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1
sp|A2RB93|GANA_ASPNC	2.09e-80	27	360	21	349	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=galA PE=3 SV=1
sp|Q5B153|GANA_EMENI	1.78e-75	27	356	22	347	Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=galA PE=1 SV=2
sp|P48842|GANA_ASPAC	2.40e-72	27	342	21	338	Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus OX=5053 GN=gal1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000167	0.999833	CS pos: 24-25. Pr: 0.9036

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_299401-t26_1-p1.