CAZyme Information: PHYSODRAFT_295406-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_295406-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1031		115782.25	7.3268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:13177219-13180608(-)

Full Sequence      

MPMPMRSPPKTVLIVVNVLPLVFERSEASASGWSVSWATGATAMLYRTLVRDADQYSPLF
IGCPEVFVAKSEEAALEKQLLALRCVPVFLEPPVAHRYFQGFCKGVLWPVFHNVVDVYNS
AELQLDCEENKKKKRDHSWFGGGKKEENSGVKSAWCDPVSWNPAAQDMCWSDYCSVNRTF
ARRVVESYHDGDLVWLHDFHFLMLPSYLLRRLCTAIVTMYLHVPFPSSEIFRCLAMRTEI
LRAMLCADHIGFLIFEHARHFLTSCKRLLGLDYKTCPNGMLVMEYNGRKVHISCSHVEPD
VTHLHEMLDQNQADANGAALDFAEHVKNAITAGRDPTQHRLVIGSVDRLEGLTAIPLKLR
AFDRFLATHPDKRGSVVLVQIGIALDSRPNDYHRTREYVLKFTEEINRRYAPPGGVVVYF
EEKRKTTCAERVILWRMCDVYLDTCVRGGLSLLPFEYMIAQHRNILSKSRASTGWSSPRG
SADVGGLDRSFGIMIVSEFSAYSRILSGSLAVNPWKTDDMAAAFAKACSMSYYEKHNRFY
LNYKFLVGKSDATPWGERLLADIEAVTDKTRDASSGEVVQVGFGFDFRVMRFESGFVSLD
VDDLVKKCTSTSRRLFILDYGGTLSSTASILDEEGAQYSYRGECADQVLQTFDVSDRYGG
ECTVQSAARYIDGKVRKPISDETRANLRTLCADPCNIVFITSNTQREALETQFGSIPNLN
LIAENGLFIRKAGKGDWECVCDEDKRTFDWKDDAKRVMRAYAARTNGSFLVENAASLLYD
YRNSDQEYGEIQSLELCAQLRHIVESGEATINRAKGYVEVHQSGVSKAVAVSLVLKVLKE
QVDVPEFVFVVGDDDSDEKVFQAVHAFAENEPKLEHVVTCTVGKKPSTAKCYVLFMPSAF
GYASVVRPLTPSSLSLRLQNLYLVPQLRLSSSRIRLFQQPRTYCRQFLKQKRLVSKEFLQ
SLERETRSLSMPSNGSASVTMGPDIDEFFAPSPSEASSTNWAALGAAVLAGCVLGAVATS
ERHRVLRRFFT

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_295406-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	11	564	3.3e-106	0.968421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	3.40e-140	2	893	52	831	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
184712	PRK14501	1.65e-115	12	893	3	710	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	7.98e-106	12	564	2	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	9.94e-98	12	565	3	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	1.84e-88	11	893	12	770	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	2.08e-145	2	893	14	816
CCA19238.1|GT20	1.77e-139	61	893	323	1063
UIZ24099.1|GT20	3.64e-138	12	893	292	1105
AJO70167.1|GT20	6.75e-120	12	893	61	827
AXH37639.1|GT20	3.47e-119	12	893	61	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	4.05e-64	12	563	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVM_A	4.90e-61	12	567	14	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.19e-59	12	563	2	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUV_A	2.21e-59	12	563	6	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	1.04e-58	12	563	6	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94AH8|TPS6_ARATH	9.25e-113	7	911	50	859	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|O23617|TPS5_ARATH	1.35e-112	12	893	62	826	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q0WUI9|TPS8_ARATH	1.20e-108	13	917	60	842	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LRA7|TPS9_ARATH	1.10e-106	13	893	62	826	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q9ZV48|TPS11_ARATH	9.53e-103	13	898	53	823	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana OX=3702 GN=TPS11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_295406-t26_1-p1.