CAZyme Information: PHYSODRAFT_293746-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_293746-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		55621.54	4.8183

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:5517684-5519389(+)

Full Sequence      

MPSCGSFAKLGWVALLAFQPSSVTSYKISVTTTTLVESWEGWGTSLSWWANVFGDRKDIA
DVLFTNMTSVSIDGAAANIPALDFNIARYNIGGSGNNVIDDSGTEIAMKVSEKMPAFKAI
ESFWLNWASTDISSSSWNWDADAKQRAMLGLASKRGANIFEAYSNSPPWWMTSNHATAGG
DDGAADNLQTEYFEKFALYLATVVSKAKKDWGIEFNYVAPFNEANSKAWSFRNHRKHLNK
LDLQSVVIAGAEEKNPDDSLFILTDMVPKELPGVDVMGKVNSHCSDGVVPYTGDNRDKLQ
GMASSVRKTMKIWDSMYADEDATGLTLAETIARDINEMGASAFVYRQALDSGAVGLIQSN
PGDKWIGTANPKYYVMAHYSRHIHAGMTILKFDDPNTLIPGSSSYALDKYPNFVVAYDKA
TKVLVIVASNSGDAQAITFDLSALAYVAGPINIWTTETNSTTRATYKTSSLDIMFGRSAR
FTADLPAQSITTLEIVGAELSGTVSFWELL

Enzyme Prediction     

EC	3.2.1.164:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	31	493	1.2e-87	0.9912280701754386

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
405300	Glyco_hydr_30_2	3.19e-11	27	223	3	182	O-Glycosyl hydrolase family 30.
227807	XynC	2.47e-10	154	493	113	426	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
399741	Alpha-L-AF_C	0.004	361	489	63	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26121.1|GH30_5	1.90e-150	14	495	16	496
ATB44315.1|GH30_5	1.41e-113	38	497	46	496
QRN98147.1|GH30_5	1.14e-109	38	497	47	497
ADO68177.1|GH30_5	3.60e-108	38	497	47	497
EAU67098.1|GH30_5	3.60e-108	38	497	47	497

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	5.12e-06	118	440	83	455	Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q76FP5|6GAL_HYPRU	1.07e-83	13	500	9	478	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
sp|A0A401ETL2|EXGAL_BIFL2	7.23e-09	38	299	48	343	Exo-beta-1,6-galactobiohydrolase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=bl1,6Gal PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000299	0.999683	CS pos: 25-26. Pr: 0.9778

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_293746-t26_1-p1.