CAZyme Information: PHYSODRAFT_293339-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_293339-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: putative chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	JH159151|CGC29	33132.13	5.2689

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:3296226-3297176(+)

Full Sequence      

MKFAGVIASVGLMAVAAAGTCKHSRFTSPPSMRPAPSEADSLSSSSSGTSAKIPGSDSSS
GSESFSASESGSSSASGSSISASTSSSSSGTNSTAAPSSTSGSSSLSGFARFFDQERFRS
MFPDAVSLYNFGGLVNAASKYTAFANTGNDDNDKRELAAFLAQTAHESDSFKAAEEYAWN
TYSVWQYCDSSVITCAPGSRYHGRGPIQLSWNYNYDQAGKALGLDLLNNPDIVASNTDVA
WMTALWYWMTPQGSHSIHDVVADTNGFAQATKIINGALECGPSAPNKASEQHRIEYYTKM
CETLHVQPLGSSSCNA

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	111	312	1.2e-65	0.961038961038961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	2.21e-71	113	314	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	6.95e-54	125	314	21	232	Chitinase class I.
225720	COG3179	2.54e-14	115	278	6	187	Predicted chitinase [General function prediction only].
381610	chitinase-like	3.65e-06	159	275	1	105	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN31509.1|GH19	9.34e-121	109	316	27	234
CCD28125.1|GH19	1.42e-114	109	316	53	260
UIZ22871.1|GH19	9.74e-114	109	316	48	256
AIG55513.1|CBM1|GH19	2.97e-58	112	314	24	222
AKJ27151.1|CBM12|GH19	1.08e-57	115	314	165	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CJL_A	1.49e-51	115	314	5	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
3WH1_A	3.91e-49	118	314	13	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	2.12e-48	118	314	12	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
1DXJ_A	6.90e-47	129	314	29	234	Structure of the chitinase from jack bean [Canavalia ensiformis]
3W3E_A	2.72e-46	129	314	30	235	Structure of Vigna unguiculata chitinase with regulation activity of the plant cell wall [Vigna unguiculata],3W3E_B Structure of Vigna unguiculata chitinase with regulation activity of the plant cell wall [Vigna unguiculata]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36907|CHIX_PEA	1.43e-45	129	315	107	314	Endochitinase OS=Pisum sativum OX=3888 PE=2 SV=1
sp|P86473|CHIT_ACTCC	1.16e-44	127	314	98	307	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2
sp|P05315|CHIT_SOLTU	2.02e-43	127	314	104	313	Endochitinase OS=Solanum tuberosum OX=4113 PE=2 SV=1
sp|Q41596|CHI1_THECC	3.36e-43	125	306	95	298	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|P21226|CHI2_PEA	9.98e-43	129	312	95	310	Endochitinase A2 OS=Pisum sativum OX=3888 GN=CHI2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.605352	0.394636

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_293339-t26_1-p1.