CAZyme Information: PHYSODRAFT_286434-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_286434-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: putative endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		42412.99	4.2069

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159155:5450700-5451908(-)

Full Sequence      

MVRVLSLSAAAAVAVLASSTAALDQKLYGINYDLRQGPDWDPSKCKSADTIASDLKVLST
ITSNVRTYSLSDCDVSGVLTAAKKLSLTVWLGVWVSEDSKVYDNEVKAFKELISAGLIDS
NVVGINVGSEAVYREDITAEQAIEYVTDFRKVMADNDISVPVSITDIVDTFVQYPDMLKA
GDIVTINQFPFWEKTPANKGAAQFNKRIQPLLKLAGDMEVIISETGWPTGGTATNGSVAS
EENAAIYLNDFYELAEAKKWKYYYFAGFDTPYKEKQADDATTVESHFGIFDETGTMKSAY
ADLKFTKTGDYSTSSGSSTTTSSGSSSEAVGTVSPGGSGTSTTTSSGTTGTTGTTGTSDA
TTSSSNTDTTSSATTADSGSSQLMAASLAACLGVVSTMLWSL

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_286434-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	44	297	6.9e-24	0.9453376205787781

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.06e-43	29	290	47	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.24e-19	29	297	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56146.1|GH17	7.59e-81	16	308	11	303
AIG55438.1|GH17	9.74e-81	17	308	13	314
AIG55390.1|GH17	1.07e-78	3	307	2	313
AIG56392.1|GH17	1.19e-77	22	307	19	310
AIG56195.1|GH17	8.34e-73	15	308	5	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.93e-35	25	289	35	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.13e-34	25	289	35	281	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15703|BGL2_YEAST	1.99e-23	8	297	9	305	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|P43070|BGL2_CANAX	1.22e-22	41	305	31	307	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	5.91e-22	41	305	31	307	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|Q0CI96|BTGC_ASPTN	1.02e-20	23	297	354	641	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|Q2U492|BTGC_ASPOR	1.06e-20	23	297	384	671	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000560	0.999403	CS pos: 21-22. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_286434-t26_1-p1.