CAZyme Information: PHYSODRAFT_284485-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_284485-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591		65653.17	7.0495

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:10072703-10074478(-)

Full Sequence      

MLRQSLRRSPAGLRRLQPVPALRSASAAAAASSSSSEYDYVIVGGGSAGCVLANRLSEDA
ANKVLLVETGPSDRGKWDSWKIHMPAALTYNLGDDKYNWYYYTEPQKHLNGRRLPWPRGR
VLGGSSSLNAMVYIRGHAYDYDDWQASGADGWSYADCLPYFRKAQNHELGPDDYRGGDGP
LHVIRGNQKDQILFKKFIDAGVQAGYPFTDDMNGYQQEGFGWMDMTVHKGMRWSTASAYL
RPAMTRPNLTVVTDTFVSKVVFEGKKAVGVETEDRESKTTKQVRAAKEVILSGGAINSPQ
LLMLSGIGDADHLKEVGVPVVQHLPAVGQNMEDHLDLYIQYMCKKPITLHNATWKYPHKM
VGIGLEWILRQTGMGASAHLESGGFIRSAPGKRHPDLQYHFLPGSLTGQLTPGAYHAMQA
HCSPMRALSRGWLKLRSNNPHEHPIIEPNYLSVEEDMVDMRNGVKLTQEILEQQTLDEYR
GDPISPSKEVQTDAQIDEWIRQNTESAYHPSCTNRMGVDDNTVVDPQTRVHGVENLRVVD
ASIMPNIVSGNLNAPTIMIAEKAADIILGKTPLPKSTAPVYQPENWETSQR

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_284485-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	37	568	2.3e-172	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	0.0	37	573	7	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	0.0	37	591	5	555	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.03e-63	110	336	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	9.87e-44	429	563	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.66e-27	38	559	56	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	0.0	41	591	31	581
CAB3230510.1|AA3_2	9.24e-242	41	590	28	578
ANI26486.1|AA3_2	6.74e-236	41	590	74	624
AWP09430.1|AA3_2	2.80e-232	41	583	23	566
CEF60566.1|AA3_2	1.02e-190	41	573	36	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	1.27e-87	41	578	11	571	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	1.27e-87	41	578	11	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.78e-87	41	578	11	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.90e-87	41	578	27	587	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	2.50e-87	41	578	11	571	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	5.66e-241	41	590	49	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.37e-235	41	590	44	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8BJ64|CHDH_MOUSE	1.70e-234	41	590	46	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	8.83e-190	41	591	8	554	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	2.51e-187	41	591	8	554	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_284485-t26_1-p1.