CAZyme Information: PHYSODRAFT_264003-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_264003-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	JH159151|CGC10	47702.29	4.1445

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:12417610-12419046(+)

Full Sequence      

MKIFCYGFICAFVLAVRSAAAINTGTAPGLASGATGGGDVDPVYPTTIDELTSYLLDDEA
RVIILQQEFDYRGSEGTTTETGCRPLSNQECIAKNNGCKGQDVILQSGGMSVTGSCTDGI
SVEVTYDNAGPNPLQVQGNKTIRGVGTSGVIIGKGLWILGSNVIVQNIHNTNLNPHLVWG
GDAIYIQGADGGETAQENVWLDHVKFSSIGRQMIAINTASVKSMTISNCDFDGYTEYSAS
CDNRHYWTMLFYGTETQVSLVNNYVHQTSGRSPKVGGNTILHAANNYFYNNSGHNFNPID
ESYTLAEGNYMDTCTEPVLLDDTSSAIMVPASGTQSYCESALGRDCIVNTVVNSDSELTG
QNDESAVKAAATVGKAYDAAAAATLTLSSLNFGVGDLDAIDDSTSSGATSSSSTATSSNS
ASSSGSSTAAQMSASTAAPTVASTEASTSSSGAEIRNF

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	312	9e-79	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	7.55e-31	124	310	4	185	Amb_all domain.
226384	PelB	2.88e-10	73	325	44	287	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.11e-07	132	309	28	209	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19254.1|PL1_4	1.65e-257	1	405	1	406
ACR19247.1|PL1_4|4.2.2.10	4.39e-164	1	397	1	398
ACR19251.1|PL1_4	4.39e-164	1	397	1	398
ACR19255.1|PL1_4	2.51e-163	1	397	1	398
ACR19252.1|PL1_4	3.82e-158	18	397	52	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDJ_A	1.19e-81	24	349	4	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	2.36e-81	24	349	4	313	Pectin Lyase A [Aspergillus niger]
1QCX_A	5.78e-79	25	387	5	352	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0YCL3|PELB_ASPFC	6.58e-88	16	362	14	344	Probable pectin lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelB PE=3 SV=2
sp|Q5BA61|PELB_EMENI	2.95e-87	15	349	14	333	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|Q8NJK6|PELF_ASPNG	3.19e-87	24	354	25	341	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	3.19e-87	24	354	25	341	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|A2RBL2|PELD_ASPNC	4.81e-84	14	360	13	340	Probable pectin lyase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999724	CS pos: 21-22. Pr: 0.8631

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_264003-t26_1-p1.