CAZyme Information: PHYSODRAFT_263887-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_263887-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
500		51428.24	4.3550

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:12398577-12400107(-)

Full Sequence      

MKIFRYGFICAFVLAVRSAAAIDTGTAPGLASGATGGGDVDPVYPTTIDELTSYLLDDEA
RVIILQQEFDYRGSEGTTTETGCRPLSNQECIAKNNGCKGQDVILQSGGMSATGGCTDGI
SVEVTYDNAGPNPLQVQGNKTIRGVGTSGVIIGKGLWILGSNVIVQNIHITNLNPHLVWG
GDAIYIQGADGGETAQENVWLDHVKFSSIGRQMIAINTASVKSMTISNCDFDGYTEYSAS
CDNRHYWTMLFYGTETQVSLVNNYVHQTSGRSPKPTTTSTTTRATTSTPSTSPTRWRMDT
CTEPVLLDDTSSAIMVPASGTQSYCESALGRDCIVNTVVNSDSELTGQNDESAVKAAATV
GKAYDAAAAATLTLSSLNFGVGDLDAVDGSSSSGTTNSSSTASSTSSTVVATVVPAGTST
SSSGTSTSSAFASSGSDAAVTQSSSVSSTTAPSSSSGSTAAYTSTNSAASAATTTSTLPP
STSRDNDIRQGQFGQGQFGK

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	280	6.1e-68	0.8021390374331551

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.45e-22	124	271	4	147	Amb_all domain.
226384	PelB	1.98e-06	97	207	51	164	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.20e-04	132	268	28	160	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19254.1|PL1_4	3.89e-224	1	391	1	405
ACR19247.1|PL1_4|4.2.2.10	1.10e-142	1	384	1	398
ACR19251.1|PL1_4	1.10e-142	1	384	1	398
ACR19255.1|PL1_4	6.25e-142	1	384	1	398
ACR19252.1|PL1_4	2.52e-136	18	384	52	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDJ_A	1.03e-60	24	336	4	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	1.45e-60	24	336	4	313	Pectin Lyase A [Aspergillus niger]
1QCX_A	2.03e-60	25	380	5	358	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	5.96e-69	24	391	25	390	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	5.96e-69	24	391	25	390	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q00374|PELA_COLGL	1.07e-67	16	274	17	260	Pectin lyase OS=Colletotrichum gloeosporioides OX=474922 GN=PNLA PE=3 SV=1
sp|Q5B3J8|PELF_EMENI	1.29e-67	25	356	24	348	Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	1.92e-67	1	350	1	346	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999756	CS pos: 21-22. Pr: 0.9591

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_263887-t26_1-p1.