CAZyme Information: PHYSODRAFT_262301-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_262301-t26_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		45317.92	5.8248

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159156:2082818-2084143(+)

Full Sequence      

MGHIQLALAAALAFVAKDASAFNIGSPAGMAAGTTGGEGGEVVYPTSTSELIQYLNDTEP
LVIVLNQTFDFRGTEGSTTEMGCRPENMRKCLAKNNGFKGQDVILGPGGMNNTGGCTNGT
EIEVTYDNAAQKRMNVKGNKTVRGVGKKGVIMGKGMTLNGDNIIIQNVHVTELNPHGNTT
AKNIWLDHVKVSRVGRQMVVTNKAGVDSLTISNSDFDGNTEYSSSCDGHHYWTFLFYGKN
TGISMLNNYIHATSGRSPKVGGNKNENIVVHIASNYWGDNSGHSFEIGANAYVLAEGNYF
NNTKQPLDPKGSDGNLYATDSNDVCSNYLTRSCKSNTLVSSGNFTSRNGPAVLEAVKANS
AITGYSASSAQTEQQSSQTNDSEQQEQYTPGTAKPSTETTQSFAQASDLADVWAQTTDNF
GVGKLD

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	302	3e-71	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	7.00e-27	124	304	4	190	Amb_all domain.
226384	PelB	1.76e-11	124	345	85	315	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74069.1|PL1_4	8.98e-216	1	426	1	441
ADN18835.1|PL1_4	3.64e-215	1	426	1	441
AHX74068.1|PL1_4	3.19e-158	8	370	8	384
ADN18834.1|PL1_4	1.29e-157	8	370	8	384
ADN18833.1|PL1_4	2.83e-149	1	371	1	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	6.83e-64	24	345	4	323	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.35e-63	25	345	5	322	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.59e-61	25	345	5	322	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
3VMV_A	6.29e-07	28	366	8	320	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	2.61e-80	24	346	24	343	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	2.73e-79	3	353	5	351	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	2.73e-79	3	353	5	351	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2TXS4|PELD_ASPOR	1.03e-77	25	370	24	365	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|B8NVB7|PELD_ASPFN	1.03e-77	25	370	24	365	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999757	CS pos: 21-22. Pr: 0.9721

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_262301-t26_1-p1.