CAZyme Information: PHYSODRAFT_260992-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_260992-t26_1-p1
• CAZy Family: AA17|AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		33083.06	6.4791

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159158:1317570-1318600(+)

Full Sequence      

MQIVAPLVILASLVSSALADAKCTRPNARTQPPTGAIVVDATGAHPGSFKTVTEGVAHLP
NTTAEHSLFGFPGVYEEQAMVPKLNGPLVVQGYTCNTESYADNQVTITHKMAQKDVPTSI
KVERNSVTSTLGFKTGSVKIYNLNVANPEPKINQLGQSIALFVNTTTSGFYGCNVTGYQD
TMYANTGRQRYTKSYISGAVDFIFGQLSKVWFENCDIESIGNGAITANGNLNSSNLSECR
RPEGWQSWNGDNNTANVYFKEFKNSGPAAATDKRVSFSGQLDAPVAMTEILGDDYKSQWF
VDSKFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	38	232	1.6e-35	0.6319444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	3.86e-28	40	279	1	276	Pectinesterase.
178372	PLN02773	2.04e-25	31	281	1	282	pectinesterase
215383	PLN02713	4.32e-25	35	279	250	529	Probable pectinesterase/pectinesterase inhibitor
178606	PLN03043	4.45e-25	48	279	234	502	Probable pectinesterase/pectinesterase inhibitor; Provisional
215367	PLN02682	2.25e-24	33	281	67	347	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54869.1|CE8	1.48e-127	1	306	1	338
ACO54873.1|CE8	2.67e-127	6	306	7	344
ABQ63096.1|CE8	7.61e-127	6	306	7	344
ACO54875.1|CE8	2.44e-123	10	306	7	346
ACO54870.1|CE8	2.05e-122	6	306	7	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	7.27e-35	29	295	3	291	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.02e-34	29	295	3	291	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.98e-17	37	279	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	2.35e-16	47	279	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	2.02e-08	73	215	74	239	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.00e-49	29	305	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	4.53e-43	9	306	5	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|B8NPS7|PMEA_ASPFN	3.14e-41	12	305	14	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	1.82e-39	12	297	14	318	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	3.00e-36	29	297	28	318	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999800	CS pos: 19-20. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_260992-t26_1-p1.