CAZyme Information: PHYSODRAFT_260939-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_260939-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		24771.72	5.3717

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159156:684583-685281(-)

Full Sequence      

MPTGAWPTSQGDEFFDEPYVVKKGEVFDGKMKTYQRSNVKCAGQTESGWETAVFRVEPGG
TLKNVIIGQDQMEGVHCEQSGCTIQNVWWDAVCEDALSIKGGSPSSVVKVIGGGARSATD
KVIQHNGDGTVSIDGFYVEDFGKLYRSCGTCGYKGLKVNVKNVYAVNGRVSLVTVNENWG
DEATIGNVKIKGKKINVCSWSDGTTSGGEPDEAGAGPKGKLCNYSPSTITYV

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	10	202	2.7e-78	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	7.08e-88	3	207	1	199	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18840.1|PL3_2	7.06e-131	1	231	31	260
ADN18837.1|PL3_2	5.78e-130	1	232	31	261
ADN18841.1|PL3_2	2.73e-101	1	229	21	250
ADN18839.1|PL3_2	4.24e-88	1	232	23	276
AHX74070.1|PL3_2	4.24e-88	1	232	23	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	9.51e-27	21	162	11	147	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	8.96e-22	20	189	15	181	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	9.17e-22	20	189	16	182	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	8.18e-21	20	189	24	190	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	8.18e-21	20	189	24	190	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ20|PLYG_ASPTN	3.27e-71	7	225	28	240	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	4.21e-68	7	225	23	236	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	4.21e-68	7	225	23	236	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	2.33e-67	7	225	22	235	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	6.73e-67	7	225	43	258	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_260939-t26_1-p1.